KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2015
Entry
BMA10247_A2015    CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A2015
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A2015
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABO02732
UniProt: A0A6C6YK96
Position
II:complement(1948615..1949046)
AA seq 143 aa
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPM
QMAGATKINPVHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKARED
GAELRASLALDYLSGYFSLADDR
NT seq 432 nt   +upstreamnt  +downstreamnt
gtgagcgatcttcaactctacaacaagctgtcgaaacggattcgtcgccattcgctgcaa
gaggtcgtggccgaccacttggtcgatctgatgaatcacgcgatccgcggtgcgcgcatg
cgcatcgcggacgacagcccggccgcgcattcggtgctgaacttcggttgtccgccgatg
cagatggccggtgcgacgaagatcaatccggttcatgcggccgcgcatatctgcgaggtg
attcgccgcttcgagccgcgcgtggaccctgccagcacggtggtcaagccgcgcacggag
agccgcaagcgcctcgcgcagacgatttatttcgacgtgtcgatgaaggcgcgcgaagac
ggagccgaactcagggcgagcctcgcgctcgactatctgagtggttatttcagcctggcg
gacgaccgatga

DBGET integrated database retrieval system