KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2016
Entry
BMA10247_A2016    CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10247_A2016
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A2016
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A2016
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABO03292
UniProt: A0A6C6YMA3
Position
II:complement(1949126..1949653)
AA seq 175 aa
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFE
FRMVSNKASPKLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPI
SQLGHASGEVDGVLPTDQIRINFVQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcaaatgctttggttgattacttcttgcagatcgatggcgtcgagggtgagtcgacc
gatcagcaatatcccggtctgatccagatccagagctggcagtgggcggaagagaactcg
ggccgctggggcttcggcagcggcggcggcgcgggcaaggtcgagatgaaggacttcgag
ttccgcatggtgtcgaacaaggcgtcgccgaagctgttcctgatgtgcgcgacgggtgag
cacatccagaatgcgaagctgatctgccgcaagtcgggcaagggccagcaggagttcctg
acgatctcgttcgcgagcggcctcgtgtcgtcgttccgcacgctcggcaacatgccgatc
tcgcagctcggtcacgcgagcggcgaagtcgacggcgtgctgccgacggatcagatccgc
atcaacttcgtccagatcgagttcgagtaccgcgagcagcgcaacgacggcacgatgggc
gccgtgatcaaggcgggctacgacctgaagcagaacgcgccgatctaa

DBGET integrated database retrieval system