KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2017Help
Entry
BMA10247_A2017    CDS       T00479                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A2017
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB DNA_pol_phi
Motif
Other DBs
NCBI-ProteinID: ABO03786
Position
II:complement(1949797..1951302)
Genome map
AA seq 501 aa AA seqDB search
MQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVR
EDVAQTIEQLVAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLN
ISKADLGKTLRRFKGVVWDQSPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILT
EMSKISAAAHAPFIAAAAPGLLQMDDWSELSNPRDVSKIFTATEYAFWRRLRESNDSRYL
ALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFCWANSAYAMGANITRAFKTYGWC
TKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSESGLMPLVYRKNSD
TAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSAED
TQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLE
GLTVSLRLVSKLPSTKHEVTT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcttgaatcgtctgccgagaaggtggtcgtcgatcagaacaacgtcaacgag
gatctgaaggacatcctgcgccgctcgttccggccgcgcaccaacgaggcggccgaggcg
gtgcagaacgcggtcgagacgctgctcacgtatgcgcggcgcagccgggtcgtggttcgt
gaggatgtcgcgcagacgatcgagcagctggttgccgagctcgacaagaagatctccgag
caactgacgctcgtgctgcacaacaagcgctttcagagcctcgaaggcgcgtggcgcgga
ttgcactacctcgtgtcgaacaccgatacgagcgagaacctgaagatccgctacctgaac
atctcgaaagcggatctcggcaagacgctgcggcgcttcaagggcgtcgtgtgggatcag
agtccgattttcaagatgatctacgagcaggagtacggccagttcggcggcgagccgttc
ggctgcctgatcggcgacttctatttcgaccacagcatgcaggacgtgtcgatcctcacc
gagatgtcgaagatctcggcggccgctcacgcgccgttcatcgcggctgccgcgcccggc
ctgctgcagatggacgactggagcgagctgtcgaacccgcgcgacgtgtcgaagatcttc
acggcgaccgagtatgcgttctggcggcgcctgcgcgagagcaacgactcgcgctacctc
gcgctcacgctgccgcgcttcctcgcgcgtgtgccgtatggtccgaagacgcagcccgtc
gaagagttcggcttcgaggagaaggtcgatccgaaccgcgcggaggatttctgctgggcg
aactccgcgtatgcgatgggcgcgaacatcacgcgcgcgttcaagacctacggctggtgc
acgaagattcgcggcgtcgagtcgggcggcgcggtcgaggtgctgccgaagttcgtgctg
ccgtcgcaggatcgcgaagtcgatctgcattgcccgaccgagatcgcgatctcggaccgc
cgcgagcacgaattgtccgagtcgggcctgatgccgctcgtgtatcggaagaattcggat
acggccgcgttcatcggcgcgaagaccgtgcatcgtccggcgatctacgaggacgacgac
gcgaccgcgaactcgaacctgtcgtcgcggctgccgtacatcttcgcgacctgccgtttc
gcgcattacctgaagtgcatcgtgcgcgacaagatcggttcgttcaagtcggccgaggac
acgcagcgctggctcaacgactggctgatgaactacgtggacggcgacccgagcatctcg
agcgaggtgacgaagtcgcagcgtccgctgtcggcggcggaggtggtcgtcgacgagatt
ccggaaaaccccggctactatcgcgcgcagttcttcctgcgcccccatttccaactggag
ggtttgaccgtttctctccggctggtttcgaagcttccgtcgaccaagcacgaggtgacg
acctga

DBGET integrated database retrieval system