KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2179Help
Entry
BMA10247_A2179    CDS       T00479                                 

Definition
(GenBank) ImpE/SciE family protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A2179
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BMA10247_A2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE
Motif
Other DBs
NCBI-ProteinID: ABO03560
Position
II:complement(2116792..2117757)
Genome map
AA seq 321 aa AA seqDB search
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGERA
VGQLQAYARFAAQHAHIAHAYRDLIRAERFHARVMAGQARPGFVFDAPPWIDDLLEALRA
QAAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFS
DLAGWRLARPGVLLALVWAPCVLTLADGSVAHGFMPARYPGSELADGGGAPGASAAAHEA
DAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTSAGDAGLFELHACEFGARARA
GAVLGGAAREARGGEAADGCA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcctgccttcccggcgccgcccggcgcacgcacgtcggcccggccgcacgat
acgccgctcgacgcgcggctcgcggctgcgcaagccgcggtgcgcgcccggcccgtcgat
gcggcgagccgttgggcgctgtttcaactgctctgcgtgacgggccagggggaacgcgcc
gtcgggcagttgcaggcttatgcgcggttcgccgcgcagcacgcgcacatcgcgcacgcc
tatcgcgacctgattcgcgccgagcgctttcacgcccgcgtgatggcgggccaggcgcgg
ccgggattcgtattcgatgcgccgccgtggatcgacgatctgctggaagcgttgcgcgcg
caggcggccggcgcgcgcgacgaagccgaccgcgcgcgttcgcgcgcgctcgatcgcgcg
ccgttcgtcgcggggcgcgggccggatgcgccgttcgactggatcgccgacagcgattcg
cgattcgggccggtctgcgaagtcgtgaccgccgggcatgatcgttggctgccgttttcg
gatctggccggatggcggctcgcgcgcccgggcgtgctgctcgctctggtctgggcgccg
tgcgtgctcacgcttgccgacggcagtgtcgcgcacggcttcatgccagcgcgttacccg
ggctccgaactggccgacgggggcggcgcgccgggcgcctcagcggccgcgcacgaggcc
gatgcgcacgagagcgccgcgcgcgaggccgatgcgttgcggctcggcagccggaccgca
tggcgcgacgtcggccgcaccggcgtgttcgcgctcggccgcaagacctggtcgacgagc
gcgggcgacgccggccttttcgagctgcacgcgtgtgaattcggcgcgcgcgcccgtgcg
ggcgccgtgctcggcggcgcggcgcgcgaagcgcgcggcggggaggcggccgatggatgc
gcatga

DBGET integrated database retrieval system