KEGG   Borrelia miyamotoi LB-2001: I871_04275Help
Entry
I871_04275        CDS       T02797                                 

Definition
(GenBank) peptidase ClpP
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bmo  Borrelia miyamotoi LB-2001
Pathway
bmo00770  Pantothenate and CoA biosynthesis
bmo01100  Metabolic pathways
Module
bmo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    I871_04275
Enzymes [BR:bmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     I871_04275
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     I871_04275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGT27752
Position
complement(861714..862778)
Genome map
AA seq 354 aa AA seqDB search
MTDNATKFITPLTLEIVSQNRVIKSLWDTTHEEVEHIKLARWANLILIIPATYNIISKIA
SGIADDALSTIISASSVPVYFAVAMNDIMYQNPILKENIAKLKKYNYKFIEPEEGFLACS
LNAIGRLKSENDIFNIISKELDPKLPLKGKKILITASRTEEALDPIRYFSNKSTGQMGFT
LGIEARDLGADVTIITGPSDEKTPYGINVIRIKTASEMYKEAIKIYQEFDVIIAAAAVAD
FRPEKVYDLKIKKNTMKDLNIKFIQNPDIIKHIGKNKTKNQVVIGFCAQKDEILIKQAKE
KLKTKNLDYIIANDLKYFGSRLNKIYIINQNSIKELPEMSKKETAKEILKILYQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaatgcaaccaaatttattacccctctaacattagagattgtctctcaaaat
agagtaattaaaagtttatgggacacaacccacgaagaagtagaacatataaaactagca
agatgggcaaatttaatattaattattccagccacatacaatattatctctaaaattgcc
tcaggaattgctgatgatgccttaagcacaatcatatctgcaagcagcgttccagtttat
tttgcagtagcaatgaatgacataatgtaccaaaaccccattttaaaagaaaacattgca
aaattaaaaaaatataattacaaattcattgaacctgaagaaggatttctggcatgctct
ttaaatgctattggacgccttaaaagcgaaaatgatattttcaatataatctcaaaagag
ctagatccaaaattacctttaaagggtaaaaaaatactcataactgcgtccagaactgaa
gaagcattagatcctattcgttacttctcaaataaatcaacaggtcaaatgggctttact
ttaggaattgaagctcgagatcttggagctgatgtaacaataattacaggccccagcgat
gaaaaaacaccttatggaataaacgttattagaatcaagacagcatcagaaatgtacaaa
gaagcaataaagatatatcaagaattcgacgtaataattgctgctgccgccgttgcagac
tttaggcccgaaaaagtttatgatcttaaaatcaaaaaaaatactatgaaagaccttaat
atcaagttcatccaaaatccagatataataaaacatataggtaaaaataaaactaaaaac
caagttgttattggattttgtgctcaaaaagatgaaattctaataaaacaagctaaagaa
aaactaaaaactaaaaatttagattatattattgcaaatgacttaaaatattttggatca
agattaaacaaaatttatataataaaccaaaacagtattaaagaactacctgaaatgtca
aaaaaagaaactgcaaaggaaattttaaaaatattatatcaataa

DBGET integrated database retrieval system