KEGG   Bombyx mori (domestic silkworm): 100101212Help
Entry
100101212         CDS       T02817                                 

Gene name
MOF
Definition
(RefSeq) MOF protein
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100101212 (MOF)
Chromosome and associated proteins [BR:bmor03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100101212 (MOF)
   HAT complexes
    NSL complex
     100101212 (MOF)
    MSL complex
     100101212 (MOF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1 IF2_N HTH_9 HTH_11 DUF2314 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 100101212
NCBI-ProteinID: NP_001093305
UniProt: A5JPL6
Position
Un
AA seq 442 aa AA seqDB search
MAKGDKELEKPIVNNELPNPECRSTDNEDSESVPEQPLDIGEHYLVRRSDESWHPAEIIQ
SRYSTAESCYEYYVHYVGYDRRLDEWVSRHRVMSDRFDVCEQSNNNINCDHLLTDKSGRK
ITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYIDRIQIGKYEIDTWYFSPY
PDEYGKQSKLWLCEYCLKYMRMEKTYRYHLSECTARQPQGNEIYRKGTIAIFEADGKEHK
IYCQNLCLLAKLFLDHKTLYFDIEQFLFYILCEVDKQGAHLVGYFSKEKDSPEGNNVACI
LTLPPYQRQGYGKLLIAFSYELSRLEQVVGSPEKPLSDLGKLSYRSYWSYVLLEVLSASR
GTLSIKDLSQMTGISQTDIISTLQSMNMVKYWKGQHVICVTPKIVAEQLASPHFKKPRLS
IDPSALRWTPPSKQGNSAKAKK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtgataaagaattagagaagccaatagtgaataatgagttgcctaatcct
gagtgtagaagtactgataatgaagactccgagtcggtcccagaacagcctttggacata
ggagaacattatttagtgcggcgatcggatgagtcatggcacccggctgagattatacag
tcgcgatacagtacagcggaatcttgttacgaatattatgtccattatgtcggatatgat
agaagactcgacgaatgggtgtcccgccaccgggttatgtcagataggttcgacgtatgc
gagcagtcgaacaataacataaactgcgaccacctgctcacggacaaatccggccggaaa
ataacaaggaatcaaaaacgtaaacatgacgaaataaaccatgtgcagaaaacttacgcc
gaaatggatccaacgaccgccgcgcttgaaaaggaacatgaagctattactaaagttaaa
tacatagacaggatacaaattggaaaatatgaaatcgatacttggtattttagtccgtat
cctgatgaatatggtaaacaatcaaaattgtggttatgtgaatactgtttgaagtatatg
agaatggaaaaaacataccggtaccatctcagtgaatgcacagcacgccaaccccagggt
aacgaaatatacagaaaaggtacaatagctatttttgaagcagatggcaaagaacataaa
atatattgtcagaatttgtgtttattagccaaattatttttagatcacaaaaccctttat
tttgatatagaacagtttttattttatatattgtgtgaagttgacaagcaaggagctcac
cttgtaggatatttttcaaaagaaaaggattcacctgaaggcaataatgtggcatgtata
ttgactctacctccatatcagagacaggggtatggtaaactcctgatagcttttagttat
gaactctcaaggctcgaacaagttgttggaagtccagagaagcctttatcagatttaggc
aagttaagttacagatcgtactggtcatatgttttattagaagtgttaagtgctagtaga
ggtacattaagtatcaaggatttaagtcagatgacaggaatatcacaaacggacatcatt
tcaactttacagtcaatgaacatggtgaagtactggaaaggacagcatgttatttgtgtt
acacctaaaatagttgctgaacaattagcaagcccgcactttaaaaaaccacggttgtca
atagatccttcagcactgagatggacgccccctagtaaacaggggaactctgccaaagcc
aaaaagtag

DBGET integrated database retrieval system