KEGG   Bombyx mori (domestic silkworm): 100141455Help
Entry
100141455         CDS       T02817                                 

Gene name
Hig, Bmhig
Definition
(RefSeq) hikaru genki
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Ig_3 Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 100141455
NCBI-ProteinID: NP_001108468
UniProt: Q8T107
Position
Un
AA seq 786 aa AA seqDB search
MSLAIGSEMCFSFFKCLLRLGICYPNPLRSSGGIPYRWKSQTHAILHSLRDRQCDVLLIL
QVPLETGHLLSNPSEELRRDSLSVEVSDSRDREVFFSTGENRWIPTRTCVCGSRTSLNSC
RSQPGLYPEPGGNTVGAIETAAQGLRRAYYTHPAVPQTPNRSLGRQAKSPFLPAQNGWCL
KLFGGRITDGTPVLIPCSAAADFCVVRRALPHPPRRLLLRDGTLAEVKHSLPRHVAAKHR
HHDARQRQVRSYLCDKDTALHLPSEADSERMLRRVQVVSTMVAPRRRLSSYLVQVLPEAF
VPSQHLHQTEGESSSATIYPVIKNRVNRLDEISNEIYFVLCTLQVKFPGLIGPLNERLIC
KIKCIDGNWVGPLCASTPGNVYFKFNRGRLLSTYFIRNGASLNTNAPDDLSTTTLKKSLH
EMFFQKETSFPHGSSIVARCIHFGFYKLKGDNTMHCENGEWVPKFPECVPTSVITNFTGD
APPTIQYAIISGSAVVEPTGELFVFPDSTLRLDCVTPRALGNPEWSWTQALGNYETGWSS
DEGEKYTHYRLTLSKMSARHSDTYTCATPTGHTNTVIVKVVNVVCPTINVSSPRLRQFTQ
GTRLGHSAHFSCQSGFHLNGSAILTCMGNGHWSTSLPTCLETFCPMLKSLGPHLSFVEYN
SSFWGRAVFQCAWGYRLVGSPGLECEHDGQWSGEVPICSPIYCPDPLVPEKGRLLIEPSS
KHGKYTVGDLMIYDCEDGYDIVGESSIVCTENGYWSHPPPFCLLPSVIKKADTIFIENIT
LVHVEE
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgcgatcggcagtgagatgtgtttctcgttcttcaagtgtcttctgagactg
ggcatttgctatccaaaccctctgaggagctcaggcgggattccctatcggtggaagtct
cagactcacgcgatactacattcgcttcgcgatcggcagtgtgacgtgcttctcattctg
caagtgcctcttgagaccgggcatttgctatccaatccctctgaggagctcaggcgggat
tccctatcagtggaagtctcagactcacgcgatagagaggtttttttttccacaggagaa
aatcgctggatccccacccgcacgtgcgtatgtgggagtcgaacctcactaaactcctgc
cgctcacagccggggctctaccccgaaccgggtgggaacacagtcggagctattgaaacg
gcggcacagggtttacgtagagcatattacacccatcccgccgtcccccagacgccgaac
cgttccctcggtcgacaggccaagagcccgttcctccccgcacaaaacgggtggtgcctg
aagctcttcgggggccggattacggacgggaccccggtcctgatcccctgctcggcggcg
gcggatttctgcgtagtgaggagagctttgcctcacccgccccgccgcctacttctgcga
gatggtacactcgcagaagtcaagcatagccttccaagacacgtcgctgccaagcatcga
caccacgacgccaggcagcgacaagtccggtcctatctttgtgacaaggatacggcgctg
catctcccaagcgaggcagacagtgagcgtatgctccgccgtgtccaggtcgtgtccaca
atggtggcacctcgtcggcggctcagctcctatctagtgcaggtacttcccgaagcattc
gtgcccagtcagcacctgcaccagacagaaggtgagtcgtcctcggccacgatttaccca
gtcatcaaaaaccgggtaaaccgcctcgacgaaatatcaaatgagatatattttgtgcta
tgcactttacaggttaaatttcctggtttgattggtccattaaatgaaagattaatctgc
aaaattaagtgcatcgatgggaactgggtaggaccgctttgcgctagtactccgggtaat
gtatactttaaattcaatcgtggacgtttgttgagtacgtatttcattagaaacggtgca
tcgctcaatacgaatgcaccggacgacttatcgacgacgacattaaaaaaaagtcttcat
gaaatgttctttcagaaagaaactagttttccacatggctcttcaatagtggcaaggtgt
atacatttcggtttttataagctgaaaggagataacacaatgcactgtgagaatggggag
tgggtgccaaagtttccagaatgcgttccgaccagtgtcatcactaattttacaggcgac
gctccacccactatacagtacgcaattataagtggttcagcagttgtagaacccacagga
gaattgttcgttttccctgacagtactctacgtctagactgtgttactccaagagcttta
ggcaacccggaatggagttggacgcaagcccttggaaattacgaaaccggctggtcatcg
gacgaaggcgagaagtatacccattacagactgacgctgtcaaagatgtccgcgcgtcat
agtgacacgtacacttgtgccactccaacgggacacaccaatacagtgatcgttaaagtt
gttaatgtagtttgtccaacaataaacgtgtcttcgcctcggctacgtcagtttacacaa
ggaactagacttggtcattcggcccactttagttgtcaatctggttttcatcttaatggc
tctgcaattttgacttgtatgggaaacggtcattggtcaaccagccttccgacatgcctg
gaaactttctgtcccatgttgaagtctttaggtcctcacttaagtttcgttgaatataat
tcgtcattttggggtcgtgccgtatttcagtgtgcctggggctacaggcttgtgggttca
ccaggtttggaatgtgaacatgacggtcagtggtctggagaggtgccaatttgttcacca
atctattgccctgatccattagtcccagaaaagggacgtctgctaatagagccatcttca
aagcacggcaaatatactgttggggaccttatgatatatgattgcgaagacggttacgac
attgtcggagagtcttctatagtctgtactgaaaacggatattggtcacatcccccacct
ttctgcctactcccttcggtgatcaaaaaggctgatactatatttattgagaatataaca
ttagttcatgtcgaagaataa

DBGET integrated database retrieval system