KEGG   Bombyx mori (domestic silkworm): 100529202Help
Entry
100529202         CDS       T02817                                 

Gene name
rock1
Definition
(RefSeq) Rho-associated protein kinase
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100529202 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmor01001]
    100529202 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmor03036]
    100529202 (rock1)
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100529202 (rock1)
Protein kinases [BR:bmor01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100529202 (rock1)
Chromosome and associated proteins [BR:bmor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100529202 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Kinase-like PH C1_2 C1_1 PH_11 Pkinase_C Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 100529202
NCBI-ProteinID: NP_001188507
UniProt: E3VQ36
Position
Un
AA seq 1360 aa AA seqDB search
MEVKDEDRMRRLHALEERLCDPRSTGNVDCLLDTVTALVSDCDHPAIRRMKNVEAYTSRY
EEFSSEIINLRMKAADFHLIKVIGRGAFGEVQLVRQKSTNHVYAMKLLSKVEMIKRSDST
FFWEERHIMAHANSDWILKLHFAFQDHKYLYMVMDYMPGGDLVSLMSNYDIPEKWAKFYT
MEIVLALDVIHGMGFVHRDVKPDNMLIDKHGHLKLADFGTCMRMGLDGLVRASNAVGTPD
YISPEVLQSQNGEGVYGRECDWWAVGIFLYEMLIGDPPFYADSLVGTYGKIMDHRNSLQF
PDDVEISKEAKSLIRGLLTDRTKRLGRNSVDEIKQHPFFINDQWSFENLRDSVPPVVPEL
SSDDDTRNFDDIEKSDALDESFPVPKAFVGNHLPFVGFTYNGDYQLCTRQKKANDVVDTI
SNNHINNDGSEAIYQLEKLLERERDGKRKLEDTQAALCAQLEELSQRELRNKKIISESDK
EVALLRHDLKEIQRIAELEVESRRKAEANLNEAKRRLEEEQTKRTKEMSNLHIYNEKINA
LEKQLEELREKLKQESEAAAKSRKQAAELSAAQAAAAAVNDGTVTSLRAQRDALERERSI
LSEELSEVKAARQRSEAAVTEATCRLNAAHAELERTSTRLSQMIADNRQLTERVSSLEKE
CTSLSHELRSAQHLYQQELRAHQDTQRSQLLSKQEANLELVKTLQTKLNEEKTARQRSES
ACQEKDRQMSMLSVDYRQMQQRLQKLEGEHRQESEKVCGLVASLEQERAARLAASGEVSA
AEAAARTALAERDARARDLHAVRAALHDASEKLAAASAERDMYYARSEELRSQLENEQHY
CHVYRSQVNEIRTQVEESSRAARDLEQERSSLLHQLQLAIARADSEAIARSIAEETVGEL
EKEKTMKELEMREAVSQHRAELAARDNMLQGLRDRDHENRATIDLQRKEVDELRRSGTAL
AERVASLQRLQDELDRLNKKLNSEIMLKQQAVNKLAEIMNRKDMNPTAGKNKSKMSVRKD
KDYRKLQQELTREKEKFDQHISKLQRDLQDCQQQLLDEQSTRLRLAMEVDSKDAEIEQLK
EKLAALTSETASQSSADAEDGENEQILEGWLSVPFKQNIRRHGWKKQYVVVSSKKIIFYN
SENDKQNTTDPVMILDLSKVFHVRSVTQGDVIRADAKDIPRIFQLLYAGEGEARRPDQQD
QPQDSTDHQGNTVQHKGHDLVSITYHIPTACEVCTRPLWHMFRPPQAYECRRCRMKIHAE
HLTEGEGVAACKLHADRARELLLLAPAAPEQRRWVARLARRVQRHGYRAAHHNHDHRLSP
RYARTPPTHTRTTYAHTKGPCPFSLGVWAPKKSRVMMVLT
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaggatgaggatcgcatgaggcgtcttcatgcgttggaggaacgtttgtgt
gacccccgttccaccggtaatgtggactgtctactggataccgtcactgcgctcgtgtcc
gattgtgaccatccagctattcgtcgcatgaaaaacgtcgaagcctacactagtagatat
gaagagttttcttcagaaattattaatctgcgaatgaaggcagctgatttccatttaatt
aaagtgattggacgaggggcatttggtgaagtacaactagtcagacaaaagtctaccaac
catgtttatgccatgaaacttcttagtaaagtagaaatgattaagaggtcagactccaca
ttcttttgggaagaaaggcacattatggcccatgccaactcggactggatactaaaatta
cattttgcatttcaagatcataaatatctttatatggttatggattatatgcctggtggt
gatcttgtcagtctaatgtcgaactatgacataccagagaaatgggcaaaattctacaca
atggagattgttcttgctctggatgttattcatggcatgggatttgtccatagagatgta
aaaccagacaatatgttgatagataaacatggccatttaaaactagccgattttggtact
tgtatgagaatgggactggatggtttagttcgagcaagcaatgctgtgggaactcctgat
tatatatctcctgaagttctgcagtcacaaaatggtgaaggagtatatgggcgtgagtgc
gattggtgggcagtaggaatatttttgtacgaaatgcttattggtgaccctcctttttat
gctgatagtttagtgggcacgtatggtaaaattatggatcacaggaattctttacagttt
cctgatgatgttgagatctcaaaagaagcaaagtctctaattagaggacttttaactgat
agaactaaaagattaggtagaaacagtgtggatgaaattaaacagcatccattttttata
aatgatcaatggagttttgaaaatctgagggattctgtacctcctgtggtgcctgaactc
tccagtgatgatgatactaggaactttgatgatattgaaaaatcagatgcacttgatgaa
tcctttcctgtaccaaaagcatttgttggtaatcatttgccatttgttggtttcacttat
aatggtgattaccaattgtgcactcgccaaaagaaagcaaatgacgtagtagacacaata
tctaataatcatatcaacaatgatggatctgaagccatatatcaactagagaaactgctc
gaaagagaaagagatggcaaacgtaaactagaagatactcaagctgccctatgtgctcag
ctcgaagaactatcacagagagaactacgcaataaaaaaataatttctgaaagcgataaa
gaggttgcattactgagacatgatcttaaagaaattcaacggatagctgaactggaagta
gaatctagacgaaaggctgaagctaatctcaatgaggcaaaacgccgtcttgaagaggaa
caaaccaagagaacgaaagaaatgagtaatttacacatatacaacgaaaaaattaacgca
ttagaaaaacagctcgaagaattgcgagagaaactaaaacaagagtctgaagcagcagcc
aaatctaggaagcaagctgccgagctatcggctgcccaggccgccgccgcagctgtcaac
gacggcacggtaaccagcttgcgggctcaacgtgatgctctcgaacgagagagaagtatt
ttatcagaggaactgagcgaagttaaggcagctagacaacgttcggaagcggcggtcaca
gaggccacctgcagactcaatgcggctcatgcagaattggagcgcacttcgacacgatta
tctcaaatgatcgctgataacagacaattaacagaacgtgtatcttcactagagaaggaa
tgcacttcattatctcatgagttaagatcagcgcaacatttatatcaacaagagttgcgt
gcacatcaggacacgcaacgatctcagcttctctctaaacaagaagccaacttggaacta
gtcaagaccctgcaaactaagctgaacgaagaaaagactgccagacaacggtcggaatca
gcttgtcaagagaaagaccgacagatgtcgatgctcagcgttgattacagacagatgcag
cagagactccagaaactagagggcgaacatcggcaagaaagcgaaaaggtatgcgggctg
gtcgcgtcgctagagcaggagcgcgcggctcgactggcggcgtcgggcgaggtgtcggcg
gcggaggcggcggcccgcaccgcgctcgccgagcgggacgcgcgcgcccgcgacctgcac
gccgtgcgcgccgcgctgcacgacgcctccgagaaactagccgccgccagcgcagagcgg
gacatgtactacgccaggagtgaagagttgcgctctcagttggagaatgagcaacattac
tgccatgtgtatagaagtcaggtcaatgagatccgcactcaggtggaggagagttctcgc
gctgcccgggacctcgaacaagaaagatccagcttgttgcatcaactacagctcgccatt
gctagggccgactctgaggctattgcaagatcgatagcggaagagacagttggtgaactg
gagaaggagaagacaatgaaagagttagagatgcgggaagctgtgtcccagcatcgcgcc
gagctggcggcccgcgacaacatgctgcagggcctgcgggaccgggaccacgagaaccgc
gccaccatcgacctgcagcggaaggaggtggacgagctccggcgcagcggcacggcgctg
gcggagcgcgtggcgtcgctgcagcggctgcaggacgagctggaccgactcaacaagaag
ctcaactctgagatcatgctcaagcagcaggcggtcaacaagctcgccgagatcatgaac
aggaaagacatgaacccgactgcgggcaagaacaagagcaagatgtcggtccggaaggac
aaggattaccgcaagctgcagcaagagctgacccgggagaaggagaagttcgaccagcac
atctcgaagctgcagcgggacctgcaggactgtcagcagcagttgctggacgagcagtcc
accaggcttagacttgccatggaggttgacagcaaagacgctgagatcgagcagctgaag
gagaagctcgccgcgctcaccagcgagacggcgtcgcagtcgtcggccgacgcggaggac
ggcgagaacgagcagatcctcgaaggctggctctcggtgccgttcaagcagaacatacgc
aggcacggctggaagaagcagtacgtcgtcgtttcctccaagaagatcatcttctacaac
tctgagaacgataaacagaataccacagatcccgtcatgatcttggatttgagcaaggtg
ttccacgtgcgctccgtgacgcagggcgacgtgatccgcgccgacgcgaaggacatcccg
cggatcttccagctgctgtacgcgggcgagggggaggcgcgccgccccgaccagcaggac
cagccgcaggactccaccgaccatcaaggcaacacggtgcagcacaaaggccacgacctg
gtgagcatcacgtaccacatcccgacggcgtgcgaggtgtgcacgcggccgctgtggcac
atgttccggccgccgcaggcctacgagtgtcgccggtgtcggatgaagatccacgcggag
cacctgacggagggcgagggcgtggcggcgtgcaagctgcacgcggaccgcgcgcgcgag
ctgctgctgctggcgcccgccgcgcccgagcagcgccgctgggtggcccgcctggcgcgc
cgcgtgcagcgacacggctaccgcgccgcgcaccacaaccacgaccatcgcctctcgccc
aggtatgcacgcacgccccccacacatactcgtactacctatgcacatacaaaaggacca
tgcccattttctttgggcgtttgggcccctaaaaaaagtcgtgtcatgatggttttaact
taa

DBGET integrated database retrieval system