KEGG   Bombyx mori (domestic silkworm): 100862766Help
Entry
100862766         CDS       T02817                                 

Gene name
Tbh
Definition
(RefSeq) tyramine beta hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00350  Tyrosine metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100862766 (Tbh)
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100862766 (Tbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON
Motif
Other DBs
NCBI-GeneID: 100862766
NCBI-ProteinID: NP_001243923
UniProt: F1T2L6
Position
Un
AA seq 592 aa AA seqDB search
MSNWFFVFFLSVYTFIYTFSVNVSPGHRFAESESVLDPSGEFLLKWRVDYAVRKIKFTLT
VSEKAPAFNWFALGFSDRGQLNNSDVCLFWTDYKARDHFEDMHTNGQGNLIRDQKQNCEG
FYLNTNSQSIIFDRLFDTCDDDDYVIEDGTVHVVWAHGIDKLFSSKGLCLTCTVPQRHGF
VRVRLLTPPGLQKANGYQLRITNKDLKVPGDDTTYWCKVVRLPEFVTSKVHHIVQFESTI
TPGNEGLVHHMEVFYCDEDPHKEMPAYEGNCFAAERPAITKSCSKVKAAWAMGAPPFTYP
KEAGLPLGGPKANKYVMLEVHYNNPELRKDWVDSSGIVLYITGRKRTYDAAIMELGLEYT
DKMAIPGEQKAFPLTGYCIPQCTGVGLPDEGITVFGSQLHTHLTGAAVWTRHSRQGVELP
VLNKDMHYSTHFQEIRILHRPVKVLPGDFLETTCIYNTEDKLNATIGGHAITDEMCVNYI
HYYPATELEVCKSAVSNEALEKYFDFEKRWDDIPISSKATPRDNYLAIQPWTRLRADTLH
TLYVESPISMQCNKSDGSRFQGDWEGIPIPKIKLPLSEEIRICPKINYLVET
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattggttttttgtgttttttctgtctgtttatacatttatttatacgttttct
gtgaacgtaagcccaggtcatcgtttcgctgaaagtgaatcagtgttggatccaagcggc
gagtttttattaaagtggcgtgttgattatgccgttcgaaagattaaatttactttgact
gtttctgaaaaagcgccggccttcaattggtttgcattaggcttctccgatcggggccaa
ctgaataattcggatgtttgtctgttttggacagattataaagctcgtgatcatttcgag
gatatgcacacaaacggacaggggaatttgatacgtgatcaaaaacaaaactgtgaaggg
ttttatttgaatacaaatagccaaagcataatctttgatcgtttatttgatacttgcgat
gatgatgattacgtgattgaggacggcacagtccatgtggtgtgggctcacggaatagac
aaactgttctcatcaaagggcttgtgccttacttgcaccgtacctcagaggcacggcttt
gttagagtaaggctactaacacctcccggcttgcaaaaagcgaatggttaccaattacga
ataacaaacaaagatctaaaagtaccgggagacgacacgacgtactggtgcaaagtcgtt
aggctgcccgaattcgtcacgtcaaaagttcatcatatagttcagttcgaatcgacaata
actcccggtaacgaaggcctagttcatcacatggaagtcttctattgcgacgaagatccc
cacaaggaaatgccggcatacgagggaaattgttttgccgcagagagaccggctattacg
aaaagttgttctaaggtaaaagcggcatgggcaatgggcgctcccccttttacctaccca
aaagaagcgggcctcccactcggtggcccgaaagccaacaaatacgtcatgctagaagtc
cactacaacaatccagaattaaggaaagattgggtcgacagttcgggtattgttctctat
ataactggaaggaagcgtacgtacgatgccgccattatggaattgggcttagaatacacc
gacaaaatggctatacctggtgaacaaaaagcatttccgttaactggttactgtatccct
cagtgtactggagtgggcctaccggatgaaggcattacagtttttggaagtcaacttcac
acgcatttaactggtgccgcggtgtggaccagacactcgagacagggtgtagagcttccc
gtattaaacaaagacatgcattattctacgcattttcaggaaattagaatactgcatcgg
cccgttaaagtgctaccaggcgacttcttggaaaccacctgcatttacaatacggaagat
aagttaaacgcgacgatcggcggccacgctataacggacgaaatgtgcgttaattacata
cattactatccggcgaccgaactcgaggtttgcaagagcgccgtgtcgaacgaagcactc
gagaaatatttcgatttcgaaaaacgatgggacgatataccgatttcgtcgaaggcgacg
ccacgtgataattatttagcgatccaaccgtggactagattaagagccgacacactacat
acgctgtacgtcgagtccccaatatcaatgcaatgcaacaaatccgatgggagtcgtttt
caaggtgattgggaaggaattccgataccgaaaataaaactgccgctttccgaagaaatt
cgaatctgtcctaaaattaactatttagtcgagacctaa

DBGET integrated database retrieval system