KEGG   Bombyx mori (domestic silkworm): 101736147Help
Entry
101736147         CDS       T02817                                 

Definition
(RefSeq) myotubularin-related protein 2
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00562  Inositol phosphate metabolism
bmor01100  Metabolic pathways
bmor04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101736147
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101736147
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bmor01009]
    101736147
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101736147
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101736147
Protein phosphatases and associated proteins [BR:bmor01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101736147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 3-PAP
Motif
Other DBs
NCBI-GeneID: 101736147
NCBI-ProteinID: XP_004928766
Position
Un
AA seq 625 aa AA seqDB search
MDKHNSSELLSSDFSLSKNASSDSLDSDSKSSSLNSKHGQDSPHVLGDIQLLDGEKVTSV
ARDVTYLCPYSGPTRGVLKVTNYQLHFRPTDPSATLGTLSVPLGVVSRIEKVGGASSKGE
NSYGIEIFCKDMRNLRFAHRQENHSRRGIFEKLQQLAFPLSHRLPMFAFSYSESFPEDGW
HVYEPIAELRRMGVSNDMWRITRINDKYEVCDSYPSIWAVPSAADDDLLRSVATFRSRGR
IPVLSWIHPNSQATITRCSQPLVGVSGKRSREDERYIQLIMDANAQAHKLFIMDARPTAN
AVANKAKGGGYESEDAYQNADLVFLDIHNIHVMRESLRKLKELCFPQIDQSKWFSGIEAS
CWLKHIKCILAGAVRIVDKVENHKTSVLVHCSDGWDRTAQLTALSMLMLDPYYRTLRGFQ
VLIEKEWLSFGHKFQLRIGHGDERHSDADRSPVFVQWVDCVWQLQQQFPTAFEFTERLLI
TIVDHLYSCRFGTFLFNTERERVKEEVKTKTVSLWSYINSRQDLYLNALYWGSSSGATSP
SSPYSRPPVVLVPVASLRVIKLWKALYCRWNPIMRQQDPIYQRSRELVALRAQLEAAVAA
AAGDHAAKQHRRGLTPPRVASPHHV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggataaacataacagttcagaactattaagttccgacttttcgctatccaagaatgca
agttctgattcattggattctgattctaaatcaagttctttgaattctaaacacggacag
gactccccccatgtcctcggagatatacagctgttggatggtgaaaaggttacaagtgta
gctcgtgatgtaacttatttgtgcccatacagtggaccaacgaggggagtcctgaaagtg
acaaactatcaacttcactttagaccaactgatcctagtgctactctaggtacattgagt
gtgccactgggggttgtttctcgaattgaaaaagttggtggtgcttcttccaaaggtgaa
aactcatatggaatagaaattttttgtaaggatatgaggaacttaagatttgcacacaga
caagagaatcattcacgtcgtggtatatttgaaaaactgcagcagctagcttttcctctg
tcacaccgacttccgatgtttgcattcagttattctgaaagtttccctgaagatggttgg
catgtgtatgaacccattgctgagctgagacgaatgggtgtaagcaatgacatgtggcgc
ataacacgaataaacgataagtatgaagtgtgtgatagctatccgtctatatgggcagtc
ccttctgcagctgatgatgatttactacgatcagtggcaacatttagatcacgtggccgc
attcctgtactatcctggattcatcctaactcccaagctacaataaccaggtgcagtcaa
ccgttagttggggtaagcggcaagcgaagtcgtgaagatgaaaggtacattcaactaatt
atggatgcaaatgcccaggctcataaacttttcatcatggatgctcgtcccactgctaat
gctgtcgccaataaagccaaaggaggaggttacgagtctgaagacgcgtatcagaatgcg
gatctggtgttcttggacattcataacattcacgtcatgagagaaagcttacggaaacta
aaggaattatgctttccacagattgatcaatccaaatggttcagcggaatagaagccagc
tgttggctgaagcacatcaaatgtattctggctggtgctgtccgtattgttgataaggtt
gagaatcataagacgtcggtgctcgtgcattgttcggatggctgggaccgcacggctcaa
ctgacggcgctgtcgatgttaatgctcgacccttactacagaacacttcgaggattccaa
gttctaatagaaaaggagtggttatcttttggacataaatttcaattgcgcatcgggcac
ggcgacgagcgacactcggacgcggaccgctcgcccgtgttcgtgcagtgggtggactgc
gtgtggcagctgcagcagcagttcccgacggcgttcgaattcacagaacgactcctaata
actatagtcgatcacctatattcgtgtcgcttcggaaccttcctgttcaatactgaacgg
gaaagggtaaaggaagaagtgaagactaagaccgtatctctatggtcttatataaatagt
cgtcaagatttgtatttgaatgcgctttactggggctcgtcgtccggcgccacgtcgccc
tcctcgccgtactcgaggcctcccgtcgtgctagttcctgtcgcttcattaagggtcatc
aaactgtggaaagcgctgtactgcagatggaacccaataatgaggcagcaggatccgata
taccaaagatcacgtgagctggtggctctccgcgcgcagctggaggcggcggtggcggcg
gccgccggggaccacgccgccaagcaacaccgccgcggcctcacgccgcccagggtcgcc
agcccgcaccatgtctga

DBGET integrated database retrieval system