KEGG   Bombyx mori (domestic silkworm): 101736213Help
Entry
101736213         CDS       T02817                                 

Definition
(RefSeq) sphingomyelin phosphodiesterase 4-like
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: mit_SMPDase
Motif
Other DBs
NCBI-GeneID: 101736213
NCBI-ProteinID: XP_012552164
Position
Un
AA seq 141 aa AA seqDB search
MAHDLMSQFYTSLSLPLQEKVIELTRIIDQSSSTKDLQTIFPQLINNIFSSSFSTGWDLK
SITCDVNRYEFEALISFLEPQGPMFRLCYRLLSDTQLKYELPLNVLPVSIILHYIIICSI
LAKIDWIDLWLPYHIFFQLSI
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgatttgatgagtcagttttatacaagtctgagtttgcctttacaagagaaa
gtcattgaattaactagaataatagaccagtccagctcgaccaaagatctacaaacaata
ttccctcaattgatcaataacattttttcctcttcattcagcaccggatgggatttaaag
agtattacatgcgatgttaatcgatatgaattcgaagctctgataagttttttggagcct
caagggccaatgtttcgactgtgctataggttattatctgacactcagttgaagtacgaa
ttgccattaaatgtattacctgtaagtattattctacattacattattatttgtagcatt
ttggctaaaattgattggatagatctatggctcccgtatcatatattttttcaattaagc
atatag

DBGET integrated database retrieval system