KEGG   Bombyx mori (domestic silkworm): 101737109Help
Entry
101737109         CDS       T02817                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00071  Fatty acid degradation
bmor01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101737109
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmor03029]
    101737109
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101737109
Mitochondrial biogenesis [BR:bmor03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101737109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N TMEM251
Motif
Other DBs
NCBI-GeneID: 101737109
NCBI-ProteinID: XP_004927194
UniProt: H9JUV4
Position
Un
AA seq 778 aa AA seqDB search
MAEAHSAVAFSFAITHDGWDVNFDREVLYLVWESGVRSWKKRLARFRNNVLNGVYPGHLQ
SLYVLWTLLVAAHFSNFNIPFGLVDKMITIMPSNSTWAQVVACFLVALTMWFIVIFLMRY
LLKLLLMYKGWMYESRGPGAKISLKTKLWVSVVKVLSGWNKPKLYSFQGSLPRLPLPAVE
DTMNRYLLSVRPLLDNDNYKRVEKLAVEFKTKIAVKLQRYLILKSWWSSNYVSDWWEEYV
YLKGRSPLMVNSNFYGTDAILLRPTQIQAARAGVIIHLCLKFRRLIDSQELEPIMLQNMV
PLCSWQYERLFNTVRAPGIETDKLVHYQDSSHIVVYHKGKYFKVLVYLRGRLLKPAEIQV
QIQQILDDKSEPAIGEEKLAALTAGERTHWAQIRQTMFNRGHNRTSLHCIERAAFTVSLD
DMEYGYDETDPKKLDEFGHVLLHGKGYDRWFDKSFNLCFSTNGFVGFNAEHSWADAPVMG
HLWEYVIWSELEIGYQPDGNTKGTIVTNPPAPIRLQWELNKEEILSAIDISYSVAHKLLN
DVDLRILMYTKYGKGFMKKCRVSPDAFIQLILQLSYYRDASRFCLTYEASMTRLFREGRT
ETVRSCTIESTEWVRAMENPNSSIEERMALFIKASNRHQLGYQDAMAGRGIDRHLFCLYV
VAKYLELESPFLQEVFNEPWRLSTSQTPYGQTSLLDLKKYPKCVSAGGGFGPVADDGYGV
SYIIVGEDTIFFHVSSKKSCPITSSTNFVKQIEKSLHDVQTLFNDYNKLKKTNKPITD
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcattcggctgtggcattttccttcgcaataactcacgatggctgggat
gtgaatttcgaccgtgaagtcctctacctagtttgggaatcgggtgttcgatcatggaag
aaacgtcttgctcgttttaggaacaatgtactgaatggcgtgtacccaggtcatctgcag
tcactttatgtgctgtggacactacttgtagctgcccatttcagtaacttcaacatacca
tttggcttagttgataaaatgataacaataatgccaagcaattcaacatgggcccaggta
gtagcgtgcttcttagtagcgctcaccatgtggtttatcgttatatttttgatgagatat
ctgctgaaattactgcttatgtacaagggttggatgtatgagtcacgtggtcccggtgct
aaaatatcgttaaagaccaaactgtgggtgagcgtcgtgaaagtactatccggatggaac
aaaccaaagttgtacagttttcaaggctctttgcccagactccctctgccggctgttgaa
gatactatgaataggtacctactcagtgtccgaccattacttgacaatgataattacaaa
agagtggaaaaattagctgtagaattcaaaacaaaaattgcggttaaactacagagatat
ctgatactcaaatcttggtggtctagcaactacgtatcggactggtgggaggagtatgtt
tatttaaaaggtcgctcacccctgatggtcaattccaatttctatggaacagatgctatt
ttattgagacctacacagatacaagcggcccgtgcgggcgtcatcatccacctctgctta
aagttccgtaggcttatcgatagtcaagaattggaacccataatgctacaaaacatggtt
cccctgtgctcctggcaatacgagcgccttttcaacacggtacgcgcgcctggcatcgaa
accgataaacttgtgcactatcaagactcctcgcacatcgtggtttatcataaaggcaaa
tattttaaggtgttggtttacttgaggggtcgtctgttaaaaccggcagaaattcaagtg
caaatacaacagatactggacgataaatcggagccggcgatcggtgaggagaaactggcc
gcactaaccgccggagagcgaacgcattgggcccaaatccgacagacgatgttcaatcgc
ggccacaaccgtacatccctgcattgcattgagcgcgctgccttcacggtcagcttggac
gatatggaatatggctacgacgagaccgatccaaagaagctggatgagtttggtcacgtg
ctactgcacggtaaaggatatgatcgttggttcgacaaatccttcaacttatgttttagt
actaatggcttcgttggattcaatgcggaacacagttgggccgatgcgcctgttatgggt
catctttgggaatacgttatttggtctgaacttgaaatagggtaccagccggatggcaac
accaagggcactattgttactaatccgccagcgccaatacgtctccagtgggagttaaat
aaagaagaaatattaagcgccattgatatttcgtatagcgtcgctcataaactcctcaat
gatgtagacctaaggattctgatgtacaccaaatatggaaaaggtttcatgaagaaatgc
cgcgtatctccggacgcattcattcagctgattctccaactgtcttactaccgcgacgca
agccgtttctgtctcacgtatgaggcgtctatgaccagattgttccgcgaaggtcgcacg
gagacagtaagatcctgcaccattgaaagcaccgagtgggtccgcgccatggaaaatcct
aacagtagtatcgaagagcgcatggcgttattcataaaagccagtaacagacatcagctc
ggctaccaagacgctatggcgggtcggggcatcgaccgccaccttttctgtttgtatgtc
gtcgctaaatatttggaactcgagtcgcccttcttgcaagaagtcttcaatgaaccatgg
cgtctgtccaccagccaaacaccctacggtcaaaccagcctcctggatctgaaaaagtat
cctaaatgtgtaagcgcgggtggtgggttcggtcccgtcgcggatgacggctatggtgtc
tcgtacatcattgtcggtgaagatactatatttttccacgtctcaagcaagaagagctgc
ccaataaccagttcaacgaacttcgtgaagcaaatcgagaaatcccttcacgacgttcaa
acattgtttaatgattacaacaaactgaagaaaaccaacaaaccgataacagactaa

DBGET integrated database retrieval system