KEGG   Bombyx mori (domestic silkworm): 101737183Help
Entry
101737183         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101737183
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: RVT_1 Exo_endo_phos_2 Exo_endo_phos HALZ
Motif
Other DBs
NCBI-GeneID: 101737183
NCBI-ProteinID: XP_012552040
Position
Un
AA seq 1086 aa AA seqDB search
MDHTYRFLQGNLNHSAGAQDMLLQTMAEWSIDVAVVAEPYFVPPADDCWFGDVDGLAAIH
IRRSAMIPPLAMVTRGPGIVAVQLENTVVIGVYFSPNRPTVEFERFLDGLEVIARHLSPR
SVILAGDFNAKSVAWGSPSTDARGRLLEEWAVAADLCIVNRGSVATCVRWMGESIVDLTF
ASSSIAQRILGWGVVVGAESLSDHRYIRFDLSAPAPTPAAAPAEVPRITGAELRVAVVRM
TAKDTAPGPDGVHGRVLALALDALGDRLLELFNGCLESGRFPLLWRTGRLVLLQKEGRPV
DTAAGYRPIVLLDEAGKLLERILAARIVQHLVGVGPDLSAEQFGFREGRSTVDAILRVRA
LSDEAVSRGGVALAVSLDIANAFNTLPWSVIGGALERHGVPLYLRRLVGSYLEARSVECT
GYGGTLHRFPVVRGVPQGSVLGPLLWNIGYDWVLRGALLPGLRVICYADDTLVVARGDDY
RESARLATAGVALVVGRIKRLGLDVALSKSEALWFHGPRRAPPVDAHIVVGGVRIGVGVQ
LRYLGLVLDGRWAFRAHFAELVPRLMRTAGSLNRLLPNIGGPDQVVRRLYAGVVRSMALY
GAPVWAEPRNRATMARFLRRPQRTVAIRVIRGYRTVSFEAACVLAGTPPWELEAESLAAD
YRWRSEKSCNRAVALAKTRLEGAKKIVGEEKRRQLTVDNVLKDFGKKRKYRYRPELRWQN
RIGAFWDRNNVGLFPRIRKVARGKGKIENMVASKLTCYQVEKGKLVNADLCFQVTPDVEI
GALSLRSTRSSARGYASSGRESPLLLRNTTGRFASRANADAKTRRKRKTVKRPVTSAPSD
SSEIEPAPAKFLAVEERTATIAASSAKEQGVRITCGGLATGSLRGGRTRCGKAERIREGE
VERLCRSLMETDPTDLHKTFETSLDIVSKVASKSGSLKGTYVHALNCVVTAMGRLLEAFL
QRTATEETAGLRSQLESLQALYACVQSENAELRAESVTLREEMAAMRVAIDGNQNASRRQ
GVSSKSLPPSNKSSSVNPTSAANGHGPKLLLETYLFLWELEPAEQYEKLLTAIQRNTSYV
GHQRKN
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atggatcacacctatcgcttcctccaaggaaacttgaaccactccgccggagctcaggac
atgctgctccagactatggcggagtggtcaattgacgtggctgtggtcgccgagccgtac
ttcgttcccccagcggacgactgctggtttggggacgttgatggcttggcggccatacat
ataagaagatccgcgatgattcctcccctggcgatggtgaccaggggtcccgggatcgtc
gcggtacaactagaaaataccgtcgtgatcggggtgtacttctctccgaatcggcctacc
gtcgagttcgagcggttcctggacgggctagaggtgatcgctcgtcacctctctccccgt
tcggtgatactggcgggggacttcaatgcgaagtctgtcgcttggggttccccatccacg
gacgctcgtggtaggctgttggaggagtgggcggtcgcggccgatctctgtatcgttaac
aggggctcggtcgcgacatgcgtgcggtggatgggagagtctatcgtggacttgacgttc
gcgagctcgtccatcgcacagcgcatcctcggctggggcgtggtggtgggggcggaatcg
ttgtcggatcaccggtatatccggttcgatctttccgctcccgcgccgacgccggccgca
gcccctgctgaggtgccccgtattactggggcagagctccgtgtggccgttgtcaggatg
actgcaaaggacacggcccccggcccggacggagtccatggccgggtgctggccttggcc
ctcgatgccctaggggaccggctcctggagctatttaatggttgcctggagtcgggacgg
tttccgttgctctggcggacgggcagacttgtgttgttgcaaaaggaggggcgcccggtg
gatacagccgccgggtatcgtcctatcgtactgctggacgaggcgggaaaattgctggag
cgtattctggctgcccgcatcgttcagcacctggtcggggttggacctgacctgtcggcg
gagcagttcggcttccgggagggccgttcgaccgtggatgcgattcttcgcgtgcgggcc
ctctcggacgaggctgtctcacggggtggggtggcgctggcggtgtctcttgacatcgcc
aacgcatttaacaccctgccctggtctgtgatagggggggcactggagaggcatggagtg
cccctctacctccgccggctggttggctcctatttggaggccaggtcggtcgaatgtacc
gggtacggtgggacccttcaccgttttccggtcgtgcgtggtgttccgcaggggtcggtt
ctcggacccctcttgtggaacatcgggtacgactgggtgctgaggggtgccctcctcccg
ggcctccgcgttatttgttacgcggacgacacgttggtcgtggcccggggggatgattat
agagagtctgcccgtctcgccacagcgggagtggccctcgtcgtcgggaggatcaagaga
ctgggcctcgacgtggcgctcagtaaatccgaggccttgtggtttcacgggccgcggaga
gcgccacctgtcgacgcccacatcgtggttgggggcgtccggataggggtcggggtgcag
ttaaggtacctcggcctcgtgttggacggccggtgggcttttcgtgctcactttgcggag
ctggtccctcgattaatgaggacagccggttctttgaaccgactgctcccgaatatcggg
gggccggatcaggttgtacgccgcctctacgctggggtggtgcgatcgatggccctgtac
ggtgcgcctgtatgggctgagccgcgcaatcgggctactatggctcggttcctgcgccgg
ccgcagcgcaccgttgctatcagggtcatccgtggatatcgcaccgtctcattcgaggcg
gcgtgtgtgttggcggggacgccgccatgggagctggaggcggagtcgctcgctgccgac
tatcggtggcgcagtgagaagagctgtaaccgtgctgtggcccttgcgaaaaccagattg
gaaggagctaagaagattgtgggagaggagaaaagacgacagctgacggtggacaatgtg
ctcaaggactttggaaagaaaaggaagtatagatataggccggaactgagatggcaaaat
aggattggggctttttgggataggaacaacgtaggcttgtttccaagaatcaggaaagtt
gctagaggtaaaggaaaaattgaaaatatggttgccagcaaattgacgtgctaccaagta
gagaagggtaaattggtgaatgcggatctctgcttccaggtaacgcctgatgttgaaatt
ggtgcactctcactgcgctcgacgcgaagctctgcgaggggctacgcgtcgagtggtcga
gagtcgccgcttttgcttcggaatactaccggacggttcgccagcagagccaacgctgat
gcgaaaactcggaggaagcggaagacggttaagagaccggtgacttccgctccctccgac
tcctcggaaattgaacccgcgcccgccaagtttttggcggtcgaggaaagaacggcgact
attgcggcgtcgtctgccaaagaacagggtgttcggataacctgcggcggattggcaacc
ggctcgctgcgaggcgggagaacccgttgtgggaaggccgaacgaatcagggagggagag
gttgagcggttgtgccgctcccttatggagactgaccccactgacctccacaaaactttc
gaaacctctctggatattgtctccaaggtggcgagcaaatcaggctccttaaagggcacg
tacgtgcatgccctgaattgcgtggtcactgccatgggtaggctcttagaggcatttctc
cagcgcactgccacggaggaaacagctggcctgcggtcgcagctggagagtctacaggct
ttgtacgcctgcgttcagagtgagaatgcagagcttcgggcggaaagtgtaacgttgcgg
gaggagatggccgccatgcgtgtggccattgatggtaaccaaaatgcctccagacgacaa
ggcgttagcagcaagagtctaccacccagcaacaaatctagttccgttaaccccaccagc
gctgccaacgggcatggccccaagcttctcctcgagacctacctctttctctgggagttg
gagccggcagaacagtacgaaaaactcttgacagcgatacagaggaatactagctacgtt
ggacatcagaggaaaaactag

DBGET integrated database retrieval system