KEGG   Bombyx mori (domestic silkworm): 101737399
Entry
101737399         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101737399
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB
Motif
Pfam: Nha1_C BUD22 ECM1 Paramyxo_ncap DUF913
Other DBs
NCBI-GeneID: 101737399
NCBI-ProteinID: XP_004926989
Position
Un
AA seq 533 aa
MNFISNVLDSIPVVGHVKGIVHYAVGDTEGGNNSMYQSTRTSAVLAGGAVGCLAGPAGAA
LGGVYGGMITDGLVSAAKNEPVGIFESSANIGRDIASGKNPMASVGSVSFKIAMDGIGGF
GMGGVSSVASKVPAKAVAKTIEGTVKKAAATIGEEMIEKSVQLTAEEMTKIVAKKVSEKA
VKKAVETAAIQTQMLLVSAHVGVNASEKTKAEMRAEEERKQQKQKEEEKKARENRDKKNT
GSWQPPRENRNNKESNVDNEESDEEVFEKFMKLLKQLLKLLYGNNSEPFTRIFENLSPGQ
IAYLVKIIRNLNSTGILQIVLDFTLKLFKLYFSKDISFTNILSMLEFVATYIEDQLYFMT
KTKGKPTRQSDADRNERRRNAIKELQNKRDIIQKIADLFRHLQAEIIAETSAPNIISPYF
RDIFSAVYHYYKHRRVPVPGHEKLTVKQYFDLIRMVIIKMKESPEYKKMQRARNGTTLTC
EMYVVLFGRMFRIIITVRDGKIVLSTAYVVKRMNFNAKEGILYIKFDDGDVQQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgaatttcatatcgaacgtactggattcgattccggttgtaggccacgtaaaaggaatt
gttcattatgccgttggagatacagaaggaggcaacaattctatgtatcaatcaacaagg
acatcggcggtcctagcaggaggagcagttggatgcctcgcaggaccggcaggagctgca
ttgggaggcgtatacggaggcatgattacagacggcttggtttctgcggctaagaacgag
cctgtaggtatttttgagtcaagtgcaaatataggtagagacattgcttcaggcaaaaat
ccaatggcttctgtgggttccgtaagtttcaaaatcgccatggacggtataggtggcttt
ggcatgggaggagtttctagcgttgccagtaaagtcccggcgaaggccgtcgcaaaaacc
atagaaggcactgtaaaaaaagctgctgcaactattggggaggagatgattgagaagtca
gtgcaattaactgcagaagaaatgacaaaaattgtggcaaagaaagtgtcagaaaaagcc
gtgaaaaaagctgtcgaaactgcagcaatacaaacacaaatgcttctggtgtctgctcac
gtcggagtaaatgctagtgaaaaaaccaaagctgaaatgcgtgctgaagaagaacgtaaa
caacagaaacaaaaagaagaagaaaaaaaggcgcgtgaaaatcgcgataaaaaaaatact
ggatcgtggcaaccgccacgcgagaacagaaacaataaagagtccaatgttgataatgaa
gagtccgacgaggaggtatttgaaaagttcatgaaattacttaaacagctcttgaagctt
ctctacggcaataacagcgaaccgttcacaagaattttcgagaatttatcaccaggccaa
atagcgtatttggtgaaaataatcagaaaccttaactcaactggaattttacagatagtg
ttagattttacattaaaactgtttaaattgtacttttctaaagatatctcattcacaaat
atcctgagtatgttagaattcgtcgcaacttacattgaagaccagttgtattttatgacc
aaaaccaaaggtaagccgactcgtcaatcagatgccgaccgaaatgagcgtcgaaggaac
gccatcaaagaacttcaaaacaaaagggatataattcagaaaattgctgatctattcaga
catttacaagcggaaatcatagctgaaacgagcgcgcctaatataatttccccctatttt
cgtgatatattctcagctgtgtatcattattacaaacacagacgcgtgcccgtgccaggc
catgagaagctgacagtcaaacaatatttcgacttgataaggatggtaattataaaaatg
aaagaatcaccggaatacaaaaaaatgcagagggccagaaatggaacgaccctcacttgt
gaaatgtacgttgtcttgttcggtaggatgttcagaattattattactgttcgagatggt
aaaattgtattgagtaccgcctatgtagtcaagcgtatgaactttaatgccaaagaaggc
attctttacataaaattcgatgacggagatgtacagcagtaa

DBGET integrated database retrieval system