KEGG   Bombyx mori (domestic silkworm): 101737521
Entry
101737521         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101737521
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB
Motif
Pfam: DUF5759
Other DBs
NCBI-GeneID: 101737521
NCBI-ProteinID: XP_004933990
Position
Un
AA seq 249 aa
MVHRAYLIQYKPRVARVILYRSSSVLCRCVCSVLAARVVDAVVVVVGPPRRPRSPRLYVK
YWRGHSLSLPKHSILFSWTLDHTYLPQPLSSLDVSSKCDYDKIFFDFTFGGDDTQYISIT
NSEDVKSEHYDMVTAVRDNINLQIEDHILEVPEFVLGGPVSDVMSHIVVGTDELTTVDEY
ENNIKTDGIPHLTMSPLTTTQEDTIVVQRPKIERVDITHAGYKIEYMSESQMLAYRYLLN
SSRIYIVVA
NT seq 750 nt   +upstreamnt  +downstreamnt
atggtacaccgcgcgtatttaattcaatataagccgcgagtcgcgcgtgtgattctatat
cgatccagtagtgttctgtgtcgctgtgtgtgttcggtcctcgccgctcgagtcgtcgat
gccgtggtggtggtggttggacccccccgcagacctcgtagtccccgcttgtacgtgaag
tactggcgcggacactctctctctctcccaaaacactcaattttatttagctggaccctg
gatcacacctatctcccgcagccattatcatcactggatgtctcgtcaaagtgtgattac
gacaaaatattcttcgacttcacctttggcggagacgacacccagtacatctccatcaca
aactctgaggatgttaagagtgagcattatgacatggttaccgctgtcagagacaatatc
aatcttcaaatcgaagatcatattctggaagttcctgaattcgtgttggggggaccagtg
tcggatgtgatgtcacatatcgttgtgggaactgacgagttgacaacagtcgatgagtat
gaaaataatataaaaactgatggaataccgcatttgacaatgagtcccctaacgacaaca
caagaagacaccatcgtggtccaaaggccgaaaatcgagagagtcgatataacgcatgcg
ggctataaaatcgaatacatgtccgagagtcagatgctggcttacaggtacttacttaac
tcgtctcgtatatatatcgtagtggcctaa

DBGET integrated database retrieval system