KEGG   Bombyx mori (domestic silkworm): 101737547Help
Entry
101737547         CDS       T02817                                 

Definition
(RefSeq) zinc finger protein Gfi-1b
  KO
K09223  growth factor independent 1
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmor03000]
    101737547
Transcription factors [BR:bmor03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101737547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zinc_ribbon_15 zf-C2H2_3rep zf-BED
Motif
Other DBs
NCBI-GeneID: 101737547
NCBI-ProteinID: XP_004929344
Position
Un
AA seq 483 aa AA seqDB search
MEVSAMPPMPLDFSMVRSGSDSPGVAVREESPRSSTNSAFRVVTPKGLSASEALRNGLCQ
SLWSASVSRPEPRVASLPPAQNLDTYSREKIKFGINRLVGDRTDEDEEELHNNETRAEGT
SPASRCGSPCWAPSPQSPRSVRSSSPELEVDSPPSSPRRQPDSSPPPKRSEAFSVSALLR
PDAPRVQPQRPFLYPPLPFAEFLRDAGGLGLHGWGGYSNLYLHAVQAAGPELLRLRAAVL
GAPGPLTRPLPIGDVYSCVKCEKMFSTPHGLEVHARRSHNGKRPFACEQCSKTFGHEISL
SQHRALHSVAKLFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHT
YIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFACELCGRAFQRKVDLRRHKETQH
ANLRATQPMQPSHTDVHSMHSDMQIPDHRIDIRPHPELRPPHPDFGAPPHMTTAVPPLQP
LPS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcagtgctatgccgccgatgccgttggacttttcgatggtgaggagtggtagt
gattctccaggggtggccgtgcgagaagagtcgcccaggtcgtcgacaaacagcgccttc
agagtggttacccctaaaggattatcagccagcgaagccctccgcaacggtctctgtcag
tctttgtggagtgcatcggtcagcagacccgaaccgagggtcgcgtcgctaccgccggct
cagaaccttgacacttactctagagaaaaaatcaagtttggcatcaatcggctagtcggc
gatagaacggacgaggatgaagaagaactacacaacaatgagactagagctgaaggcaca
tcaccagcttcacgatgcggcagtccatgctgggctccatctcctcaatcgccaagatca
gttcgatccagttcacctgaacttgaagtggattctccaccttcatcaccacggagacag
cccgactcatcacctccaccaaaacgatcagaagcattctcggtcagcgcattgttgaga
ccagatgccccaagagttcaacctcaaagaccatttttatatccacctttaccttttgct
gagttcttgagagacgctggcggccttggtctccacggatggggaggctacagtaaccta
tatcttcatgccgtacaagctgcagggccggaattgttgaggcttcgagcggcagtgctt
ggagctccaggacctctgaccaggccattgccgatcggagatgtgtattcatgtgttaag
tgcgagaagatgttcagtacaccccatggcctggaagttcacgcgagaagatctcataac
ggcaaaagaccctttgcttgcgaacaatgcagtaagacattcggccatgaaatcagcttg
agtcaacacagggcacttcacagcgtggcgaaactcttcgagtgcaaacaatgcgggaaa
accttcaagagatcgagcactctctccactcacctgttaattcattccgacaccaggcca
tacccttgtcagtactgcggaaagagattccaccagaaatctgatatgaagaaacacaca
tacatacacaccggtgaaaagccccacaagtgccaggtctgcggcaaagctttcagtcaa
agctcgaatctgatcacacattcccgcaagcacaccggcttcaagccgttcgcttgcgag
ctttgcgggcgcgcttttcaacgaaaggtcgaccttcgccggcataaagagacgcagcat
gccaatttgagggcgacccagcctatgcagccttcgcatacagatgttcactccatgcac
tcagatatgcaaatacctgaccatagaatagatatccgccctcatcccgagttgcggcct
ccgcaccccgacttcggagcgccgccacacatgaccaccgcagtaccaccactccagccg
ttgccgtcctga

DBGET integrated database retrieval system