KEGG   Bombyx mori (domestic silkworm): 101738228Help
Entry
101738228         CDS       T02817                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00010  Glycolysis / Gluconeogenesis
bmor00562  Inositol phosphate metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101738228
   00562 Inositol phosphate metabolism
    101738228
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101738228
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101738228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101738228
NCBI-ProteinID: XP_004931927
Position
Un
AA seq 436 aa AA seqDB search
MKFLFVTVFLSVYARSVISLFCYWNTGCPYNYFSSRTPYNAARGDIRDSVIKLTDCEPIS
IWGLVRHGKRNPGAELALTMKNAIVIREYVVSSYENGNSSLCAQDIENLRELGADYGMFE
NAYQLSEEGYQEMMDIGKRFKQAFPKLLNKLESQSYTFRPAFGKWMQKSAEGFVNGLANG
NLDIEKATTDFDIMDPYTTCGKYQRDVKKNPEIYLESNKYLETTEFLATKDRIQRRLGID
YPLTNENISALYDLCRYTWSSKDKMSPWCALFTTEDLKVLEYAGDLKHYYRNGYGNSINA
HLGQIPLSDLFKSFQLAKDGKGKKIIAYFTHATMMDMLYTALNLFKDDVELTGSLRNPDR
KWRTSKLSIFGANMFAVLSRCNRENKTDYNVVFYLNEEPLKPICEQGVCTWEEFENKFKT
MNSNTDMCQFKSLPYI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttctattcgtgaccgtgtttctaagcgtttatgccagatctgtgatttcgttg
ttctgttattggaataccggctgtccatataattatttttctagcagaactccatataat
gcagccagaggggatataagagactcagttatcaaacttaccgattgtgaaccaataagt
atttggggtcttgtaagacatggtaaaaggaatcctggtgcagaattagcattgactatg
aagaatgctattgtaatcagagaatacgttgtatctagttatgagaatggaaacagctca
ttatgcgcgcaagatatcgaaaatttgagagaattgggcgctgattatggcatgttcgaa
aatgcatatcaactctctgaagaaggttatcaagagatgatggatattggtaaaagattt
aaacaagcttttcctaaattattgaacaaactggaaagtcagagctacacttttagaccg
gcttttggcaagtggatgcaaaaaagtgctgaaggattcgtaaatggactcgctaatggt
aacttggacattgaaaaggctactactgattttgacattatggatccttacacaacatgt
ggcaaatatcaaagagacgtaaaaaagaatcctgagatatacctcgaatcaaataaatat
ttggaaacaacggaatttttggctacaaaagatagaattcaaaggagattgggaatcgat
tatccattaacaaatgaaaacatatcggctttgtatgacctctgtcgatacacttggtca
agcaaagacaaaatgagcccatggtgcgcattatttacgactgaggatctcaaggtttta
gaatacgcaggagatctgaaacactattacagaaacggttatggaaactcaatcaacgct
catttaggacagattccattgagtgatttattcaaaagctttcaattagctaaagatgga
aaaggaaaaaagataatagcttatttcactcatgcaacaatgatggatatgttgtacacg
gccttaaatttgtttaaagacgatgttgaactaactggttcacttagaaaccctgacaga
aaatggagaactagtaaattgtccatcttcggagcaaatatgtttgcagtactcagcagg
tgtaatagagaaaataaaacggactacaacgttgttttttacttaaacgaagagccactg
aaaccaatttgtgaacaaggagtgtgcacatgggaggaattcgaaaacaagttcaaaaca
atgaactccaacacggatatgtgtcaattcaaaagtctaccatacatttaa

DBGET integrated database retrieval system