KEGG   Bombyx mori (domestic silkworm): 101739300Help
Entry
101739300         CDS       T02817                                 

Definition
(RefSeq) transcription elongation regulator 1-like
  KO
K12824  transcription elongation regulator 1
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101739300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bmor03041]
    101739300
Spliceosome [BR:bmor03041]
 Complex A
  U1 snRNP components
   U1 related factors
    101739300
 Complex B
    101739300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FF WW RhoGAP-FF1
Motif
Other DBs
NCBI-GeneID: 101739300
NCBI-ProteinID: XP_012544951
Position
Un
AA seq 945 aa AA seqDB search
YFTTVIDVEEDEEPQSNTDAEKEAAAAEKEKQKEEKEKAEKERLEKEKADKEKTEKEAAE
KEKAKHGRRPISTTPIVGTPWCVVWTDDGRVFFHNPTELTSVWDRPELLIGRPDVDRAVT
NPPAAVLDLLRITSTVGGKESEPGVSSTTPSVTSTADTKRPADADADAAAAAATAAKKPK
IEEKLEEVSPAEAEARAARVRVAVPHEQRVASFRAMLREKNVSAFSTWDKELHKIVFEPR
YLVLNCKERRQIFNQYVTERAEEERKEKKNRLLAKKANFKQLLDEAKLHTKSSFLDFSSK
HGRDERFKAIEKPRDREVYFNEYLAEIRKRDKEEKERKREQAKLEFIALLKEKSVDRHAR
WVDVKKKLDSEARYKAVETSGLREDYFREYCKLVKEERKKEKDGKDKGVSKKEKKDKERD
KEKKKKEKGEKQSDQSNEEENKQPTPPPDQWADILGIPRDGDKGKSARGKKPPPAKPESP
PSSPDEQLCPPKQLRSAKKDQPPPADKSSPKKRKTDEFKSPEPDKKVEKKKGDKTEKKPR
KKSEKDYGESVRLASHKRESPAALRQGRTHWPKQEPPPAEPAVEARNTGEGTGRQYHKRD
EAVQHFNALLADLVRNPDLTWREAKKQLKKDHRFGLAELLAKEDKERLFSQHTNNLASKR
RDKLRGILTELGVSCTAAWKEVKETLSSDPTTPAYASATQMEREFRDYQRDKQSAAKTAL
RQLLLETRSLTHRTRAQLRDHAHVHDALAHDARYAPPLPPLTARARSCGTTRTCTTRSRT
TPGTHPPSPHSQHARAAAGPRARARRARARRQVRTPPPPTHSTRAQLRDHAHVHDALAHD
ARYAPPLPPLTARARSCGTTRTCTTRSRTTPGTHPPSPHSQHARAGAGPRARARRARARR
QVNTPPHAQHARAAAGPRARARRARARRQLRDHAHVHDALAHDAR
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
tatttcacaacagtcatcgacgttgaagaggacgaggaaccgcagagcaacaccgatgcg
gagaaggaagccgccgccgccgagaaggagaagcagaaagaggagaaggaaaaggcggag
aaggagcgactcgagaaggaaaaggcggacaaggagaagaccgagaaggaagctgccgag
aaggagaaggcgaagcacggcaggagacccatctctaccacgcccatcgtaggaacgcct
tggtgcgtcgtgtggacggacgacgggcgcgtgttcttccacaaccccaccgagctcacg
tccgtgtgggaccgccccgagctgctcatcggccgccccgacgtggaccgcgccgtcacc
aacccgcccgccgccgtgctcgacctgctgcgcatcacgtccaccgtgggcggcaaggag
tcggagcccggcgtgtccagcaccacgccctccgtcaccagcaccgccgacaccaagcgc
ccggccgacgccgacgcggacgccgccgccgccgccgccaccgccgccaagaaaccaaag
attgaagaaaagctggaggaggtgagcccggcggaggcggaggcgcgggcggcgcgcgtg
cgcgtggcggtgccgcacgagcagcgcgtggcgtcgttccgcgccatgctgcgcgagaag
aacgtctccgccttcagcacctgggacaaggagctgcacaagatcgtcttcgagccgcgc
tacctcgtgctcaactgcaaggagcggcgccagatatttaatcagtacgtgacagaacgc
gccgaggaagagaggaaggagaagaaaaaccgattgctagcaaagaaggcgaacttcaag
caactcttggacgaagccaagcttcatacaaagtcctcgttcctggacttctcctccaag
cacggccgagacgagcggttcaaggcgatagagaagccgcgggacagggaggtatacttc
aacgagtacctcgccgagatcaggaagagggacaaggaggagaaggagcggaagagagaa
caggctaaactggaattcatagcgctgctcaaagagaagtcggtggaccgccacgccagg
tgggtcgatgtcaagaagaagctggactcggaggcgcggtacaaggccgtggagaccagc
ggcctgcgcgaggactacttccgggagtactgcaagctcgtcaaggaggagaggaagaaa
gaaaaggacgggaaagacaagggtgttagtaagaaagagaaaaaagacaaagaacgcgat
aaggagaagaagaagaaagagaagggagagaaacaatcggaccagtccaacgaggaggag
aacaagcagcccaccccgccccccgaccagtgggccgacatcctcggcatcccccgggat
ggcgataagggcaagtcggcgcggggcaaaaagccgccccccgccaagccggagtctccg
cccagctcgcccgacgagcagctctgtccccccaagcaactccgctccgccaagaaggac
cagccgccgcccgcggacaagtcctcgcccaagaaacgcaagacggacgagttcaagtcg
cccgaaccggacaagaaagtggagaagaagaagggagataaaaccgagaagaaacctagg
aagaagagtgagaaagattatggcgaatcggttcggctggcctctcacaagcgagaatcc
ccagctgcattgagacaagggcgcacacactggccaaagcaggaaccgccgccggccgaa
cctgcggtggaagcccggaacacaggggagggcacggggagacagtaccacaagcgagac
gaggccgtacagcactttaacgctctactggcggatctagtccggaacccggacctgacg
tggcgcgaagccaagaaacaactgaagaaggaccaccgcttcggactcgccgagctgctc
gccaaggaggacaaggagcgtttattcagtcagcacacgaacaacttggcgtcgaagaga
cgagacaaactgcggggcatcctgacggagctcggggtgtcttgcacggccgcgtggaag
gaggtgaaggagacgctcagcagcgaccccaccacccccgcctacgccagcgccacgcag
atggagcgcgagttccgggactaccagcgcgacaagcagagcgccgccaagaccgcgctg
cgccagctgctgctcgagacgcgctccctcactcaccgcacgcgcgcgcagctgcgggac
cacgcgcacgtgcacgacgcgctcgcgcacgacgccaggtacgcaccccccctcccccca
ctcacagcacgcgcgcgcagctgcgggaccacgcgcacgtgcacgacgcgctcgcgcacg
acgccaggtacgcaccccccctccccccactcacagcacgcgcgcgcagctgcgggacca
cgcgcacgtgcacgacgcgctcgcgcacgacgccaggtacgcaccccccctccccccact
cacagcacgcgcgcgcagctgcgggaccacgcgcacgtgcacgacgcgctcgcgcacgac
gccaggtacgcaccccccctccccccactcacagcacgcgcgcgcagctgcgggaccacg
cgcacgtgcacgacgcgctcgcgcacgacgccaggtacgcaccccccctccccccactca
cagcacgcgcgcgcaggtgcgggaccacgcgcacgtgcacgacgcgctcgcgcacgacgc
caggtaaacacccccccccacgcacagcatgcgcgcgcagctgcgggaccacgcgcacgt
gcacgacgcgctcgcgcacgacgccagctgcgggaccacgcgcacgtgcacgacgcgctc
gcgcacgacgccaggtaa

DBGET integrated database retrieval system