KEGG   Bombyx mori (domestic silkworm): 101740186Help
Entry
101740186         CDS       T02817                                 

Definition
(RefSeq) homeobox protein homothorax
  KO
K16672  homeobox protein homothorax
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    101740186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmor03000]
    101740186
Transcription factors [BR:bmor03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    101740186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeodomain DUF5641
Motif
Other DBs
NCBI-GeneID: 101740186
NCBI-ProteinID: XP_012545434
Position
Un
AA seq 359 aa AA seqDB search
MDKATEHEASLRLIQWRFIPPGAPFMGGAWERMVRAVKAALSATEQPRHPTPEIFHTLLA
EAEFTVNSRPLTHVSVSADDPDPLTPNHFLLGGPARVPVPGKFDDADLIGRAHWRAAQRL
ADVFWSPWLREYLPDLQNRREPHSRGPALKIGDVGKKRLGVVTPSFSQEVFFELSKWCPS
RREWSSPPDVARRVYSSVFLGSPGEYPGDASNASIGSGEGTGEEDDDTNGKKNQKKRGIF
PKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSN
RAVFYPSVFPHAGPSGAYSPEATMGYMMDGQQMMHRPPTDPAFHQGYAHYPAEYYGHHL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggcgactgagcatgaagcgagcttaagacttatccagtggcgcttcatccca
ccgggcgcgcctttcatgggcggcgcctgggaaagaatggtgcgggcggtaaaggccgcg
ctctcggccacggagcagccgaggcacccgacgcccgaaatatttcatactctgctagcg
gaggcagagttcacagtgaacagccgacctctcacccatgtatcggtgagcgccgacgat
cccgaccctctaacaccgaaccacttcctgctgggaggcccggcgcgagtccccgtgccg
ggcaaatttgacgacgccgacctcatagggcgcgcacactggcgcgcagcacaacgtctg
gcagatgtgttctggagtccctggctccgggagtacctgcccgacctgcagaaccggcgg
gagccccacagccgcgggcccgccctgaagataggcgacgtcggcaagaaaagactaggg
gtggtaacaccttcgttctcccaggaggtgttttttgagttgagcaaatggtgtccgtcg
cggcgcgagtggtcgtccccacccgacgtggcgcggcgggtgtactcctccgtgttcttg
ggcagccccggtgagtacccaggtgacgcgagtaacgccagcatcggctccggggagggt
acgggcgaggaagacgatgacacgaacggtaaaaagaaccagaagaagcgcggaatcttc
ccgaaggtcgccacaaatatcctgagagcgtggctcttccaacatttaacgcatccgtac
ccttctgaagaccaaaagaaacaattagcacaggacacagggttaacaatactacaagta
aataactggttcataaacgcgagacgtaggatagtccaaccaatgatcgaccaatcaaat
agagcagtgttctacccgtcagtgttcccgcacgccggccccagcggcgcgtacagtccc
gaggcgaccatgggctacatgatggacgggcagcagatgatgcacaggccgcccacagac
cccgccttccaccagggctacgcgcactacccggccgagtattacggacaccacctctaa

DBGET integrated database retrieval system