KEGG   Bombyx mori (domestic silkworm): 101740250Help
Entry
101740250         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101740250
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: KASH Spectrin LcrG
Motif
Other DBs
NCBI-GeneID: 101740250
NCBI-ProteinID: XP_012550306
Position
Un
AA seq 1627 aa AA seqDB search
MSASFEHTAMKSSFSLSSLRSAPAPPGGPCEQLERPYHSLTKKRKEPCREAWRRSWGSTA
SGGSAGDDLWPLLQRHYDYIMDNQIIDSCKEANGELLSHNPSALLSGPCLLNPTSGFNRQ
WSLNQLVSEFDELCQWLTHVQEEIYSSPENLSNWKLRANRMAELVAVEPRRAKFVEQANA
ILERIPEANGEVTWRIEHLRIKWEALRLLLSPEQPHLDGENPDTVDTAHELRCLRRWLHS
MEGRLPPPSLAAARSASHHELLRKLREHQVLQRDVECHGRIVSSVVRLCRGGDAARALER
RWHLLYLRAIEWQCHLEACLTKINTQGGTSIEAVSDSDDEPALKQPRLSRKGSPRSPRIP
RSPRRQRTPVNARCRENSTDSRQSASEEEQEYVLTYTWRGFGSDCESELMREQSNMADER
RVPGSFEDMDVRTTDQTVPVTVDQLDGLDINSSVIIEEKLKTPPTVIKRKKPIDTSKFNQ
TDRKSKHLAIFYFKHHDTDSDRQVIETDEKSQEESSEEEWTYVGGAKIANEDSTDLMTSS
VEIQCELPVDNQKDTPASPKLKLESSTPDLLRVENTRCKDIERLVNQAEEMVHKKAMAKK
KGIRNFKPLSLETDGKNVSRNKMSRIKEWLNQSPDGKNENNQNTESYDASGEYTTESEVD
TSLTSEERNLHSSMDMSTSTCTVTPTHHAKVTLRKKRAGNSTRPWSVSCLSQLSGAGASL
AATPTAADAPNMTHNMSISESALNTLASPHTVTPSNSNSKLRGSSTTVQGHVSSTNTMTE
ACTSCVEANDKQCWLRRKRFKLRRHNAPQNSRRERLVKSLSFCGRLSPEIEDKNERSAAS
DPATRKSRFDTTSTSGNDSDEELIKQQLAAMANLRKSIEKTHISTREDGAIPEQNEQNDP
ENTSKPEFKLGPAGGTVRPRLARSLERERNFLALSLGDPNQLWDLSLDKDSDVDKSVTAG
TEEHSSFSEQAWDFYQEKYNSEPYSEAPDSDAARRLLEFGDDYRAFLDSQSDCCSSLSAQ
PEHDQSPSGTRRRRPPSEMSRERSLPRHKRPTRTSPVETPSRKPKKSMSSAERKKTLLDS
LERSRNNTSLESNDGVRRRKPSDMERKKHSPEFDLLNVQALGRRRHSSNMTSDEVNSSLE
YTEVNNRPDILDSLNRRRRTEKDGEAELQKVALSELRRRSTESIDSEDETSSPKKHSRRT
WTDESESEAEEVRSLVRRSSSALDAAEALLERHEASPDLLRAFDYTEVVTRCRENINLLE
ASLAGGSLSATLQRDVRAVSARWSALRAAATRRGGARRLRREMAALRETLDDICDPADCA
PQPHTRAQLHRRIEELKDRLSRLLECKVSMLKLTVSVRRTLGEMESDDSGLATELAALLS
AWDDAHQRTSNELLSLEKAICAWAEWEGALRELQGELRGDLATLEALRDRGTIVGDQTEV
ATQIKQLAASLIEKKKGSSTCDSLSDSGISDGDSEGVGRRARRLGALRELARRLQATLAP
NSPAHRAIAKRMEQTENEVRTLQASCKALVEQNIPELKIDDDISVYFRENNVGPVAGSKT
GSGDPDYSPRGGWVWRVLRSSLPIQLCLVALLLAAWLVERPRCCDALNSLAQSLTPQLRY
VRGPPPV
NT seq 4884 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaagttttgaacacaccgctatgaagagcagtttctcgctgtcgtcactgagg
agcgcgcccgcgccgcccggcggaccctgcgaacaactcgagcggccttaccatagcctc
actaagaagaggaaggagccgtgtagagaagcctggcgccggagttggggctcgacagcg
agtggcggcagcgccggcgacgatctatggccgctactgcaacgacactacgactacatc
atggataaccagatcatcgacagttgcaaggaagcaaacggcgaattactatcacataat
ccgtcagctttgctgtctggtccgtgtctactgaacccaacatcggggttcaacagacag
tggtcgctgaatcagctcgtatccgaattcgacgagctctgccagtggctgacacacgtg
caggaagaaatatattctagtcccgagaatttgtccaattggaagcttagagcgaatcgt
atggcagaattggtggcggtcgagccgcggcgtgcgaagttcgttgaacaagcgaatgct
atactggagaggatacctgaagccaacggagaggtgacctggcgtattgagcacttgagg
atcaagtgggaagcccttcgtctgctgctcagtccggaacaaccgcatcttgacggcgag
aatcctgatacagttgacaccgcccacgagctacgttgccttcgtagatggttgcacagc
atggaaggccgccttccaccaccctcgcttgctgcagcccgctcagcctcccatcacgag
ctactcaggaaattgagagagcaccaggtattacaacgcgacgtggaatgtcatggacgt
atagtcagctcagtggtgcggttgtgccgcggcggtgacgcagcccgcgccctagaacga
cgctggcatctcctgtacctccgagccatcgagtggcagtgtcacctagaggcctgtttg
accaagattaacactcagggtggaacatcaattgaagctgtaagtgacagtgatgacgaa
ccggctctaaaacaaccgagactcagcagaaaaggctctccgcggagtccaagaataccg
agaagtccacgtagacaacgcactccggttaatgctcgctgcagagaaaactctactgac
agtcgacagtcagcatcagaggaggaacaagaatatgtactgacgtatacgtggagggga
ttcggatctgactgcgaatcggaactgatgagggaacaaagcaacatggcagacgagagg
agagtacccggctcgtttgaggacatggacgtaagaaccactgaccagactgtacctgtc
actgttgaccaacttgacggcctcgatataaacagctcagttattatagaggagaaactc
aaaacgccaccgacagtgattaaacgtaagaaaccaatagacacgtcgaaattcaatcag
accgatcgaaaatccaaacatctagcaatcttctacttcaaacaccacgatacggattca
gacagacaagttattgaaacggacgaaaaaagccaagaggaatcttccgaagaagagtgg
acgtacgttggcggtgctaaaatagccaacgaagactcaactgatctgatgacgtcatct
gtggaaatacaatgtgagctaccagttgacaatcagaaagacacaccggcatccccgaaa
ctgaaactagaatcatcgacgcctgatttactgcgagtcgaaaatactagatgtaaagac
atagagagattagtgaaccaggctgaagaaatggtgcataaaaaggctatggcaaagaag
aagggaattaggaacttcaagccattgagcttggaaactgacggaaaaaatgttagcagg
aacaaaatgtccaggatcaaggaatggctgaatcaaagtccggatggaaagaacgaaaac
aatcagaacacggaaagctatgatgcgtctggcgaatacacgacggaaagcgaagtggac
acatcacttacatctgaagaacggaacctacactcctccatggatatgagcacctccact
tgtacagtaacgccgacacatcatgccaaggttacattaagaaagaaacgcgccggtaac
agcactaggccttggtccgtatcgtgtttgtctcaactgagcggtgcgggcgcatcccta
gccgccacgccgacagcggcggacgcgccgaacatgacacacaacatgtccatatcggaa
tctgcgctaaacacgctagcctccccgcatacagtcacgccttcgaactctaactcgaaa
ttaaggggcagctctacaactgtacagggtcacgtatcaagcacgaacacaatgacggaa
gcctgcacgtcgtgcgtcgaagccaacgacaaacagtgctggttacggcgcaagcgtttc
aagctccgccgccacaacgcaccgcaaaattccaggagggagaggctggtcaagtctctg
tcgttctgcggaaggctcagccctgaaatagaagataaaaatgagaggagcgccgcgagt
gacccggctacaagaaagagcaggttcgacacgacctcaacctcgggcaacgacagcgac
gaggaactgataaagcaacagttggcagcgatggcgaacctacgcaagagcatcgagaag
acccacatatcgacacgcgaagacggtgccatcccggagcagaacgaacaaaacgatcca
gaaaacacgtccaaacccgaattcaaactcgggccggccggcggaacggttcgaccgagg
ttagcgaggagcttggaaagggaacggaacttcttggcgctaagcctcggcgatccgaac
cagctctgggatctgagtttggacaaagattcggacgtggacaaaagcgtgacggctggc
acagaagagcacagctcgttctcggaacaagcctgggacttttatcaagaaaaatacaac
tctgaaccttactccgaagccccagattctgacgccgcacgtcggttgctcgagttcggt
gacgactaccgagctttcttggattcacagtcggactgctgctctagcttgtccgcacaa
ccagaacacgatcagagccccagtggtactcgaagaaggcgacctccctccgaaatgtcc
agggagagaagcttaccgcgtcacaagcgtcccacgagaacctccccggtcgaaacgcct
tctagaaagcccaaaaagtcgatgtccagcgctgaacgcaaaaaaacattactcgacagc
ctagagagatcgaggaacaacactagtctagagagcaacgacggagtccggcgccggaag
ccatcggacatggaacggaagaaacactcaccagaattcgacttgctcaacgtgcaggct
ctcggccgccgacgtcacagctccaacatgaccagcgacgaggtgaacagctcgctcgag
tacaccgaagtgaataacagaccggacattctggactcgctgaaccgacgtcgcaggacc
gagaaagacggggaggcggagttgcaaaaggtcgcgctttctgaactgaggcggcgatcc
acagagagcattgattctgaggacgagacgtcgagtcccaagaagcacagccgaaggacg
tggacggacgaatcggagtcggaggcggaggaagtgaggtccctggtgcggcgctcgagc
tcggcgctggacgccgccgaggcgctgctggagcggcacgaggcctcgcccgacctgctg
cgcgccttcgactacacggaggtcgtgactcgttgtcgcgaaaatatcaacttactggaa
gcgagtttggctggtggttccctttctgcgacattgcagcgcgatgttagagcggtgtcg
gctcgttggtcggctctgcgtgcagccgccactcgtcgtggtggagcccggcgactccgc
agggaaatggcagcgcttcgggaaacgctcgacgatatctgtgaccctgcagactgcgct
ccccaaccgcacacaagagctcaactacacaggagaatcgaagagttaaaggatcgccta
tcgcgtcttttagaatgcaaagtttcaatgttgaaattgacggtctctgtacgtcggact
ctcggcgagatggagtcagatgatagcggtctcgctactgaattggcagcgttattatcc
gcatgggatgatgcgcatcaacggacttctaatgaacttctctccttggaaaaagcaata
tgtgcttgggccgaatgggagggtgcgctccgcgaacttcaaggggaattgaggggagat
ctagctactttggaggcattgcgtgatcgtggcacaatcgttggtgaccaaaccgaagtc
gccactcagatcaaacaattggccgcatctcttatagagaaaaagaagggtagttcaaca
tgcgactccctctcggactctggtatatctgacggagatagtgaaggtgttggcagacgg
gcgagacgtctgggtgctctgagagagctggcgcgtcgtttgcaagcgactttagctccg
aattccccagcacacagggctattgccaagcgtatggaacaaaccgaaaacgaagtacgc
accttacaagcgtcttgtaaagcgctggttgaacaaaacataccggaacttaaaattgac
gatgacatttctgtttatttcagagaaaataatgtcggcccagtagctggcagtaaaact
ggctcgggcgatcccgactacagccctcgaggtggatgggtgtggcgtgtattacgttca
tctctccccatccaactgtgccttgtcgctttattgttagccgcttggttggttgaacgt
ccacgatgctgcgatgctcttaactcccttgcccaatcgttaactcctcaactaagatac
gttcgaggacctcctccagtttga

DBGET integrated database retrieval system