KEGG   Bombyx mori (domestic silkworm): 101740340Help
Entry
101740340         CDS       T02817                                 

Definition
(RefSeq) erlin-2-like
  KO
K23341  erlin
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bmor04121]
    101740340
Ubiquitin system [BR:bmor04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101740340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 101740340
NCBI-ProteinID: XP_004931715
Position
Un
AA seq 323 aa AA seqDB search
MADQSSILAIVILAVGVTVHFSLHKVEEGHVGVYYRGGALLPVTSQAGFHMMIPLLTSYK
AIQTTLQTDEVKNVPCGTSGGVLIYFERIEVVNKLDPQSVLDMVRNFTAEYDRTLIFNKV
HHELNQFCSAHTLHEVYIDLFDQIDENLRTALQKDLHEMAPGLRVQAVRVTKPKIPESIR
KNYELMEAEKSKLLIAAQHQKVVEKEAETARRKAIIEAEKEAHVAKIQYEQKIMEKESLQ
KIELIEDSIHKAKQQTKAEADFYHLKKQAEANKLLLTREYLELKKYEALSNNNKIYFGSD
IPNMFLQANVGESVPILKGVKVE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaatcttctattttggccattgtgattctggctgtaggggtcacggttcat
ttttcccttcataaagtagaagaaggacatgttggtgtttattatcggggtggagcttta
ttaccagttacaagtcaagctggttttcacatgatgataccacttctaacatcatacaaa
gccattcagacaactttacaaactgatgaagttaaaaatgtgccttgtggcacaagtggt
ggggtgttgatttattttgaaagaatcgaggtagtcaataagctggacccacaaagcgta
ctagatatggtgcgcaacttcacagctgaatatgacaggactcttattttcaataaagtg
caccatgaactgaatcaattctgtagtgcccataccttgcacgaggtatacattgatttg
tttgatcaaatcgacgagaatttacggacagcattgcaaaaggatcttcatgaaatggct
ccaggtttaagggttcaagctgttcgcgtcacaaaaccaaaaatcccagaatcaatcagg
aaaaattacgaacttatggaagctgagaaatctaaactacttattgcagcccaacatcag
aaagttgttgaaaaagaagcagagacagcaaggcgcaaggctataattgaagcagaaaaa
gaggcccatgtagcaaaaatacaatatgaacaaaaaatcatggagaaggaatctctacag
aaaattgaactcattgaagacagtattcacaaggccaaacaacagacaaaggcagaagct
gacttttaccatctcaaaaaacaggctgaagccaataaacttcttctgacgcgggaatat
ttggagttgaagaaatatgaagcgctctccaacaataataagatttactttggaagtgat
atacccaacatgttcttacaagcaaatgttggtgaaagtgttcccatcttaaaaggtgta
aaagttgagtga

DBGET integrated database retrieval system