KEGG   Bombyx mori (domestic silkworm): 101740354Help
Entry
101740354         CDS       T02817                                 

Definition
(RefSeq) myotubularin-related protein 3
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00562  Inositol phosphate metabolism
bmor01100  Metabolic pathways
bmor04070  Phosphatidylinositol signaling system
bmor04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101740354
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101740354
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101740354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bmor01009]
    101740354
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101740354
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101740354
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101740354
Protein phosphatases and associated proteins [BR:bmor01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101740354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase3 DSPc Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 101740354
NCBI-ProteinID: XP_012552076
Position
Un
AA seq 1006 aa AA seqDB search
MLINTFLDTEDFVHLYYAEDEGTAQGCGAGARMASKYPAARPPSPEYSQVTASSSEMGER
ERYRAPPEPPPRRAADLFPRHRTHYDEPDLDAGFSPIPGEFVQWVSRTADGGTIAMSNYR
LHAQPRRRHGPGSSVPLRLIDALEIRDIQHLIILCKNGGQLKCTFNTGDQCLEWWRRLST
AALSPLTSIQDTFAAAYAAWAKEQPKSSVHRALIDDSMATQRHWFTIEMERLGFTEKGAW
RVTSVNSEFKLCPSYPPLLVVPASIGDEDLDSVARFRAMRRIPAVVWRHAGTGAVIARSS
QPEVGWLGWRSAEDERLLAAFVSSCAADRGATKLNNLLIVDARSYASAVTNRARGGGCEC
AQYYPLADIQFMCLPNIHHVRRSFQQLRALAAEPADPANWHSGVERTLWLQYLAGLGRAA
AGVCRAVAAGRPVLVHCSDGWDRTPQIVATAQIMLDPFYRTIDGFRVLVEREWLDFGHKF
SERCGHQFGPEDPNERSPVFLQWLDLVHQLQRQFPCSFQFNEAFLIKLATHVHSCMFGTF
LCASARERRAAGRGAACVWSLLRAPAYCNPLYAPAPRPDLWPDYTVRSLRLWEGVFGAPA
PPPPAPPAAPHVVPATMTKTRSCDDLLGECEKRTAQRRCSDPSLAPDLMKLSRVVKENSA
LTDSCVERLADLDDAAQQHDQVDGAPDEEPARGIGAGRGDGAGLAVGTVTACAGAEAEAE
AAAGSPEEAPVFLCDNYSDVLALGDASREGGRTRHISITWRSVSESSTHSSSPTDTAPSA
ALPADLNVDLNADLNVDLNADINSDLNVDLNADVDPAHNVQEVTAKFLEVELNGGAAWSS
GSSSSSCEGERRGASQATLCPRPRRPPTDCSGASTSWWDAAEPPDGLPLALDPLQERLHQ
IITHQKKVVEDLTGQLRECSSSSSRSSRSSGSGSASEVEVGEEARGVTWLPDSAAPRCQH
CHHHFWLARRRHHCRRCGGIFCGSCAELSPWGSRGHVRMCAPCRAR
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcaatacgtttttggacacggaggatttcgtgcacctgtattacgccgaggat
gagggtacagcgcaggggtgcggggccggggcgcgtatggcctccaagtaccctgcagcc
aggccgccttctccagaatattcacaggtgacagcgtcgtcgagcgagatgggtgagcgg
gagcgttaccgcgccccgccggagcctccgccgcgacgagccgccgacctcttcccgcgg
caccgcacgcactacgacgagcccgacctcgacgccggcttctcgcccatccccggcgag
ttcgtgcagtgggtcagtagaacggcagatggcggcactatcgccatgtcgaactacaga
ttacacgctcagccgagacgccgacacggacccggctcgtccgttcccttgcgtctcatc
gatgctttggagattcgggatatacagcatctgatcattctttgcaagaatggtggccaa
ttgaaatgtacgttcaacaccggtgatcagtgtctggagtggtggcgccggctgtcaaca
gccgcactctcgcccctgacttccatccaggacactttcgctgctgcttacgccgcctgg
gctaaggagcagcccaagtcgtccgtgcaccgagctttgatcgacgattccatggcaacc
cagcgacactggttcacgatcgaaatggaacgtttaggcttcacagaaaagggtgcttgg
cgcgtaacatctgtcaactccgagttcaagctctgcccctcgtatccgcctttactcgtg
gtgcctgcgtccatcggtgatgaagatttggactctgtcgctaggttccgtgcgatgcgt
cgcatcccggccgtggtgtggcggcacgcgggcacgggcgcggtgatcgcgcgctcgtcg
cagcccgaggtgggctggctgggctggcgctcggcggaggacgagcggctgctggcggcc
ttcgtgtcctcgtgcgcggccgaccgcggcgccaccaagctcaacaacctgctcatcgtc
gacgccaggtcctacgcctccgccgtcaccaacagagcgcgcggcggcggctgcgagtgc
gcccagtactacccgctggcggacatacagttcatgtgcctgcccaacatacaccacgtg
cggaggagcttccaacagcttcgggcgctggccgccgagcccgcggacccggccaactgg
cacagcggcgtggagcgcacgctgtggctgcagtacctggcggggctggggcgcgcggcg
gcgggcgtgtgccgcgcggtggcggcgggccggcccgtgctggtgcactgctcggacggc
tgggaccgcacgccgcagatcgtcgccaccgcgcagatcatgctggaccccttctaccgc
accatcgacggcttccgggttctggtggagcgcgagtggctggacttcgggcacaagttc
tctgagcgctgcggccaccagttcggacccgaggaccccaacgagcgctcgccggtgttc
ctgcagtggctcgacctcgtgcaccagctgcagcggcagttcccctgcagcttccagttc
aacgaagccttcctgataaagctggcgacgcacgtgcactcgtgcatgttcggcacgttc
ctgtgcgccagcgcgcgggagcggcgcgcggcggggcggggcgcggcgtgcgtgtggagc
ctgctgcgcgcgcccgcctactgcaacccgctgtacgcgcccgcgccgcgccccgacctg
tggcccgactacaccgtgcgctcgctgcgcctgtgggagggcgtgttcggcgcgcccgcc
ccgccgccccccgcgccgcccgccgcgccccatgtggtgccggccaccatgacgaagacc
cgctcgtgcgacgacctgctgggcgagtgcgagaagcggacggcgcagcgccgctgcagc
gaccccagcctcgcgcccgacctcatgaaactatctcgggtcgtcaaagagaacagcgcc
ctgaccgacagctgtgtggagagactggctgacctggacgacgccgcccagcagcacgac
caggtggacggcgcgccagacgaagagccggcgcgggggattggcgccgggcgaggggac
ggcgccgggctcgcggtcggcacggtgacggcgtgcgcgggcgcggaggcggaggcggag
gcggcggcgggctccccggaggaggcgccggtgttcctgtgcgacaactacagcgacgtg
ctggcgctcggagacgcgagccgcgaggggggccgcacccgccacatcagcatcacgtgg
cgctccgtgtccgagtccagcacgcactcctccagccccaccgacaccgcgccctctgcc
gcgctaccggctgacctcaacgtcgacctcaatgcagacctcaatgtcgacctcaatgca
gacatcaacagcgatctcaatgtagacctcaacgctgatgtcgatcctgctcacaatgta
caggaagtcaccgccaaatttctcgaagtcgaacttaacggcggcgcggcgtggagcagc
ggcagctcgtccagctcgtgcgagggggagaggcgcggcgcctcgcaggccacgctgtgt
ccccgcccgcgccggccccccaccgattgttcaggcgcgtcgacgtcctggtgggacgcg
gcggagcccccggacgggctgcccctcgcgctcgacccgctgcaggagcggctgcaccag
atcattacacatcaaaagaaagtggttgaggacttgacggggcagctccgcgagtgttcg
tcgagcagcagccgcagcagccggagcagcggcagcgggtcggcgtccgaggtggaggtg
ggtgaggaagcgcgcggcgtcacgtggctgcccgacagtgcggcgccgcgctgccagcac
tgccaccaccacttctggctcgctaggaggcgccaccactgcagacggtgcggtgggata
ttctgcgggtcgtgtgccgagctgagcccgtgggggtcgcgggggcacgtgcgcatgtgc
gccccctgccgcgcccggtga

DBGET integrated database retrieval system