KEGG   Bombyx mori (domestic silkworm): 101740569Help
Entry
101740569         CDS       T02817                                 

Definition
(RefSeq) luciferin 4-monooxygenase
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 101740569
NCBI-ProteinID: XP_004934355
Position
Un
AA seq 529 aa AA seqDB search
MPYNYNFVFGDKNVQVPAHLNFGQFMLEHIRQWNDQIAIENADTGEKLSYKEIAQYVVNL
SASLTSLGVGRGDTVALGSEKHNEFVPTLLAIVLTGATYTPYDLKVGKASLKHKLSVVKP
KYFIYSNKFWLTYSDVLKSFDCIQTYFTLEDNSEGVVSIKSLASKYVDVDLFEPTPVQGQ
IDTAAVLYSSGTTGMPKGVQLTHLNCILSSLPSNFSYESLQTVFIFGVWYHNYDTFMTYK
FLTKGKKIVYVDNPTPIAILKTIELMKVNIGFVVPSFFHYISKNDEVKNYNLDSLKIIYS
RASPLHIKTMEKVKERLPKLNYIIQGYGMTEAGELSSECWGDKGTKLGSVGKTTPGLILK
VVDPETRQVLGANRRGEICLKGPVFMKGYIGVDPSIYLDEEGFFRTGDLGYYDEDKYFYI
VDRLKEIISYQGHQVPPTELETVLLLHPAVKEAGVVGKPHPEDDELPTAFIVKRPGFNVT
EQELIDFVVAEVPPYMELKGGIRFINELPRNPRGKILRRTLRDMLLKEQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgccgtataattataattttgtgtttggtgataaaaacgttcaagtaccggcacattta
aattttgggcaattcatgttggagcatatccgacagtggaatgaccaaattgcaatagaa
aatgctgatacaggtgaaaaactatcgtacaaagaaatcgcacagtatgttgtgaacctt
tccgcgtctttgacgagccttggggtcggaagaggtgatacagtggcactcgggtcggaa
aaacacaatgaatttgttccgactttgcttgcaattgtattgactggagccacctataca
ccttacgatttgaaagttggaaaagcctcgttaaaacacaaactaagtgtagtgaaacct
aaatattttatttattcaaataagttttggttgacgtacagcgacgtcttaaagagtttt
gactgcatacaaacgtacttcactctggaagacaacagcgagggtgtggtttccataaaa
agcttagcatccaaatatgtcgatgtggatctgtttgaaccgacgccggttcaaggacaa
atagatacagcagctgtattatattcatcaggaactactggtatgccgaaaggagttcaa
ttaactcacttgaattgtatactaagcagtctaccttctaatttcagctacgaatctctg
cagactgttttcatttttggtgtatggtatcataattacgatacatttatgacgtataaa
tttttaacgaaggggaagaaaattgtttacgtggataatccgaccccaattgcgattctt
aaaaccattgaacttatgaaggttaacattggatttgtcgtgccatcttttttccattat
atttcgaaaaatgatgaagtaaaaaattacaatttagattctctgaaaataatttattca
cgcgcaagccctcttcatattaagaccatggaaaaagtgaaagaaagattaccgaaatta
aattacataattcaaggatatgggatgacagaagctggagaattaagttcagagtgctgg
ggcgataaaggaactaaactcgggagtgttggcaagactacacctggccttatactaaag
gttgtagatcccgaaacccgtcaagtactgggcgcaaatcgtcgtggcgaaatttgcctt
aaaggacctgtttttatgaagggttacataggagtagacccttcaatttacctagacgag
gaaggtttcttcagaacgggggacttaggttattacgacgaagacaaatacttttacatt
gtcgatagattaaaggaaattatttcatatcaaggacaccaggttccacccacggaacta
gagactgtcctgttactccatcctgcagtgaaagaggcgggtgtggtcggaaaacctcat
ccagaggacgatgaactgccaacagcttttatagtaaagcgcccaggatttaatgttacc
gaacaggagttaattgattttgtggttgcagaagttccaccatatatggaattaaaaggt
ggtattcgatttataaatgaattaccaagaaaccctagaggcaaaatattaagaagaact
cttcgcgatatgcttttgaaagaacagtaa

DBGET integrated database retrieval system