KEGG   Bombyx mori (domestic silkworm): 101740860
Entry
101740860         CDS       T02817                                 

Definition
(RefSeq) putative uncharacterized protein DDB_G0290521
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB
Other DBs
NCBI-GeneID: 101740860
NCBI-ProteinID: XP_004924224
Position
Un
AA seq 482 aa
MSGGTSPPIISTPGPSRKGRQVMTSLRFRPAPATRTVSMGLGTDSRPGPPVAAQRTPRIE
PEEDVLPPLTDPSGPSRPRKKARSESDRGSSSEKDKRPRIGPSSRSEGEESATTSSAHSS
TESVTPSSSRSSSPSGSPIPAQPIPKPRAPARTGTAPRQVRSPPRSPSPTLSPIPVDSTR
GAPALSGTAGNLDSTRYMDLESTRPQQVTKPNPTPSTSYAAMAARPGIPTAQRTSQSSRV
PPPRPKGRAQEELRRHPPIMVEALPNWSRHMAAIRERLGRAPSVRPFGAGFRFLPTSAEE
YRAVQAYLSEASARDVPKLLPTSGPTSTKREKNKRKKAKRKLRKREERERLRGTSEPTLP
EPQQTNIETMEVAEAPLTAQQPTSSQPLPTAHPAEGKHDLNNQPPLPPRPQRERRSGRQA
SQPAGFAAWLLALWEKLSEVISGVIHYFPCNIWYKVQRELKSLCRTITVLNKVKNAGSKS
SV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgtctggggggacatcaccccccattatcagcacccccggcccgtcccgtaagggacgc
caagttatgacgagtctaagattcagaccagcaccagcaacccgtacagtctcgatggga
ctcgggacggacagccggcccgggcctccggtcgcggcccagaggactccgaggatcgaa
ccggaggaagatgtccttcccccgttgaccgatccctctgggccctctcggccgcggaag
aaggccaggtccgagtctgaccgaggctcatcgagcgaaaaggacaagcgtcctagaata
ggcccctcgtctagatcggagggagaggaaagtgcgaccacatcctctgcgcactcctca
accgaatcggtcactccttcctcgtctaggtcttcgtccccctctgggagtccaatccca
gctcaaccaattccgaagcctagggctcccgccaggacagggacagccccaaggcaagta
agatcccctcctcgctctccttccccaacgctatctccaatcccggtagactcaacccga
ggtgcccccgccctaagcggcacggcgggcaacctggattcgaccaggtacatggacctc
gagtctaccagacctcaacaagtcactaagcccaaccccactccctccacctcctatgct
gccatggcagctaggccaggtatccctaccgcccagaggacttcccaatcctcacgagtc
cctcccccgaggccgaagggtcgcgcccaggaggaactgcgccgacacccgccaattatg
gtggaggcccttccaaattggtcccgccacatggcggccattagggagcgcctaggccgc
gccccctcggtgcgacccttcggcgccggttttagatttctgccgacgtcggctgaggag
tatagggcggtccaggcctacctgtcggaggcctctgccagggacgtgcctaaactactc
ccgactagcggccctacgtccactaaaagggagaagaataagaggaaaaaggctaaaagg
aaattaagaaaaagggaagaaagagagagactaaggggtacatctgagcccacattgcca
gaaccccaacaaaccaatatcgaaaccatggaggtcgctgaggccccccttactgcccaa
caaccgacatcaagccaaccactgcctacagcccatccggccgaaggcaagcacgacttg
aacaaccagccccccctacccccccgccctcagcgcgagcgccgcagcggtcgacaggcc
tcccagcctgccggctttgctgcatggctgctcgcactgtgggagaaattgtccgaggtg
atctccggagtaatccactacttcccatgcaacatatggtacaaggtacagagggaactg
aagtccctctgcagaaccataacagtgttaaataaagtgaagaatgctggatcgaagtca
agtgtgtaa

DBGET integrated database retrieval system