KEGG   Bombyx mori (domestic silkworm): 101740964Help
Entry
101740964         CDS       T02817                                 

Definition
(RefSeq) UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00510  N-Glycan biosynthesis
bmor01100  Metabolic pathways
Module
bmor_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101740964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bmor01003]
    101740964
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     101740964
Glycosyltransferases [BR:bmor01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   101740964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 101740964
NCBI-ProteinID: XP_004925546
Position
Un
AA seq 395 aa AA seqDB search
MLSLILLMILSLIAFLITDELIHKLKNLFINAGLYGIDLCKTDKNKIPEALGVVSGCVFL
ITCFLFIPIAFGNGLMDTQHFPHNEFAEFLAALLSICCMLLLGFADDVLDLRWRYKLVLP
TVASLPLLVVYYVNFNSTTFIIPIPFRSWFGVSVNIGFLYYIYMGMLAVFCTNAINILAG
INGIEVGQSFVIALSIVVFDIIELQGDQYKAHTFSLHIMIPYLATTLGLLKHNWYPSRVF
VGDTFCYVSGMTFAVVGILSHFSKTVLLFFLPQIINFIYSVPQLFHFIPCPRHRLPKFSA
ETNLLHASRSIIIKKDMNVFTKVMLQILTLLRLVDFTEDNESITINNMTLINLFLIKLGP
MSEVMLTKKILLFQILCSCVAFVIRYPLATYFYDK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttatcattgatattattgatgattctttcattgatagcttttttaatcactgatgaa
cttattcataagttaaagaatttattcataaacgccggcttatatgggatcgatttatgc
aagactgataaaaataaaataccagaggccttaggtgttgtatcaggatgtgtcttccta
ataacatgttttttatttattcccatagcgtttggaaatggattaatggatacacaacat
tttcctcacaatgaatttgcagaatttctggcagcattgttatcaatttgctgcatgcta
cttcttggatttgctgatgatgtgttagatcttagatggaggtataaacttgtgcttcca
acagtggcatcattgccattacttgtggtgtactatgtcaactttaattcaacaacattc
ataatacctataccatttagatcgtggttcggagtttctgtgaatattggctttttgtat
tatatctatatgggtatgcttgctgtcttctgtacaaatgcaatcaatatcttagctgga
attaatggtatagaagtaggacaatcatttgtcattgcactttccattgtggtatttgat
attatagaacttcaaggagaccaatacaaggcccatacattttctctgcatataatgata
ccttatttggcaacaacactaggactgttaaaacataattggtatccatcaagagttttt
gttggtgatacgttttgctatgtgtcagggatgacctttgcagttgtaggcattctaagt
catttcagtaaaactgttttactttttttcttgcctcagattattaacttcatatattct
gtccctcaattatttcattttattccatgtccaaggcacaggttaccaaaatttagcgcc
gaaacaaatttactccatgccagtagatctattataataaaaaaagatatgaatgttttt
accaaagtaatgcttcaaattttaactttattacgcctagttgactttacggaagataat
gaaagtataactataaataatatgactcttatcaatttatttttaattaagctcggacca
atgtctgaagtaatgctcaccaaaaaaattttgttatttcaaattttatgtagttgtgtt
gctttcgttatcagatatcccttagcaacttatttttatgataaataa

DBGET integrated database retrieval system