KEGG   Bombyx mori (domestic silkworm): 101741067Help
Entry
101741067         CDS       T02817                                 

Definition
(RefSeq) dual serine/threonine and tyrosine protein kinase-like
  KO
K16288  dual serine/threonine and tyrosine protein kinase [EC:2.7.12.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmor01001]
    101741067
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101741067
Protein kinases [BR:bmor01001]
 Serine/threonine kinases: Other
  Other
   101741067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo IKKbetaNEMObind
Motif
Other DBs
NCBI-GeneID: 101741067
NCBI-ProteinID: XP_004927694
Position
Un
AA seq 1120 aa AA seqDB search
MAGGCAWSRRVGARTRTLRGLVRDTQRALNDVCDILNYDPDILVTVQDIGNQLARSTAIV
VLGSTPSAKARLLHCLLGRQLLPDSPPRGCRWLRIQYGSTTQVHLTLGNSEFELVEELEC
NKRPWETLPVEDLLRRDNADASTILEVEINNQFLRDGLKIIIPPDISVEPGLADHLTLKK
LHHELYTKRESILRSINPVYLYGIDRMGKNIFSDNIMNSLVVSKSEEDFWDSFNLYCMSK
SEREREKTEIVIDREDREWNSTREPCVFSGENCLDLHQIKEINPNAQVMFVLFSDSAETC
GAGRGGGAARLLLDVEATESTEGSVCCDELPESDQGLVQIRNNNGSPTSKAQDDRRLHEA
QIAFLNELLDQWELMSSRPQKHQVKSQWMILNELAVHRGGEGGAGGARGAGSRTALLGAV
VRFATDTALADLLQRATRLGEIHVKLLQQFILASYDMARELQVVPKKIQYVARQEQQLYE
TIHEKFTEGDKKHELLRIMQDVLQEMKHEINNMDWSVDDLPCHQDHRFTVSSSTFYSARP
SPEHPRDWSRSPDPSDGEEAVSYDTYNFDDYEIIQQGLDTFGDSLPMRVRPEEDASKFNN
IKIENEYESCSVSSARSGWAVATGSDVTTCTNNTNVSIKQASLDVQQTVLSKLSRKISLK
LVKFVDCLKNTYFGTLQRCLESLESSCRQELGGLPASEAMRQLLSVAWQVDLQPCASFSV
LRTLIESLRRLLHKLKIVSGEDDDACCVLSPVWRRHVAMHAAHSLNPHRLARLISTQILE
KLSTAHERYQSALASLEAALTGRLHHTEDVKLAIRKKHAPSFARLCLESTSLCDMLMHGV
PELGREIGRGQYGVVYAVRGSWGGHSPVAVKSVLPTDERHYHELAMEFFYTRSIPAHPRI
VRLYGSIVQRQSSGPSVLLVSERKCRDLHAAVRAKLPFSTRMRISCDIVDGIRYLHSLGL
VHRDIKTKNVLLDGADRAALSDLGFCTAGALMSGSVVGTPVHMAPELLAGDYHASVDVYA
FGILFWYVCAGDIKLPSAFETFQNKEQLWSKVKRGLRPERLPQFSDECWEIMESCWASEP
SQRALLGDVQNKLERILEQALKDEKSPGYLAPDEPDLNDD
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgggtgtgcgtggtcgcgacgtgtgggcgcccgaacgaggactcttagagga
ttagttcgggacacacagcgggctctgaacgacgtctgcgatatattgaattatgatccg
gatatcctggtaacagttcaagatataggcaaccagttagcgagaagcacagctatcgta
gtactagggagcacgccgtcggccaaggctagacttttgcactgcttgttgggacgacag
ctgctgccggattctccgccgagaggatgcagatggcttcgtatccagtacgggagcaca
acccaggtccacctgaccctcggcaactcagagttcgagctcgtcgaagagttggagtgc
aacaagcgtccctgggagacgctgcccgttgaggatctcctacgacgagacaacgccgac
gcctcaacgatactagaagtggaaatcaacaatcaattcctaagagacggcctcaagatc
atcatacctcccgacatcagcgtcgagccaggcctagcagaccacctgaccctgaagaag
ctccaccatgaactgtacacgaaaagagaaagcatcttgaggagcatcaacccggtatac
ctgtacggtatcgacagaatgggaaagaacatcttcagcgataatataatgaattcgctt
gtggtgtcgaagagcgaagaagacttttgggacagtttcaatctgtactgcatgagcaag
agtgagagggagagagagaagactgagatcgttatagatagagaggacagagagtggaat
tcaacgagggagccttgtgttttcagtggggagaactgcctggacctgcaccaaatcaag
gagataaatccgaacgctcaagtgatgttcgtattgttctcggacagcgcggagacgtgc
ggcgcggggcgggggggcggcgccgcgcggctgctgctcgacgtggaggcgacggagtcc
accgagggctccgtgtgctgcgacgagctgccggagagcgaccagggcctggtccagata
cggaataataacgggtctccgacatcgaaagctcaggacgacagacgactgcacgaagca
caaatagcttttttgaacgagcttctcgaccagtgggagcttatgtcgtcccggccgcaa
aagcaccaagtcaagagccagtggatgatcctgaacgagctggcggtgcaccgcgggggc
gagggcggggcgggcggcgcgcggggggcggggtcgcgcacggcgctgctgggggccgtc
gtgcgcttcgccactgacaccgcgctggccgacctgctgcagcgcgccaccaggctcggc
gagatccacgtgaagctgctccagcagttcatcctggcctcgtacgacatggcccgagag
ctgcaggtggtgcccaagaagatccagtacgtggcacggcaggagcagcagctgtatgag
actatacacgagaagttcaccgagggtgacaagaagcacgagctgctgcggataatgcag
gacgtgctgcaagagatgaagcacgagatcaacaacatggactggagcgtcgacgacctg
ccgtgccaccaggaccaccgcttcaccgtgtccagctctacgttctactcggcgcggccg
agtccggagcacccgcgcgactggtcgcggagccctgacccgtcggacggcgaggaggcc
gtctcctacgacacctacaacttcgacgactacgagatcatccagcagggcctggatacc
ttcggggactcacttccgatgagggtccgacccgaggaggacgcgtccaagttcaacaac
atcaagatcgagaatgaatacgagtcgtgctccgtgtcgtcggcgcgcagcggctgggcg
gtggcgaccggcagtgacgtcaccacctgcaccaacaacaccaacgtctccatcaagcag
gcgtcgctggacgtgcagcagaccgtgctatcgaagctgagccgaaaaattagtttgaaa
ctggtgaagttcgtggattgcctcaagaacacgtacttcggtacgctgcaaagatgtcta
gaatccctagaatcatcttgcagacaggagttgggcggtctaccggccagtgaagcaatg
aggcagctgctctcggttgcctggcaggtggatctccagccctgtgcctccttctctgta
ctgaggactctaatcgaatcactgagacgtcttttgcataaattgaagatagtgagcggt
gaagatgatgacgcgtgttgcgtgctgagtccggtgtggaggcgccacgtggcgatgcac
gccgcgcactcgctcaacccgcaccgcctcgccaggctcatatccacgcagatcctagag
aagctaagcacggctcacgaacgctatcaatcggcgctggcgtccctcgaggcggccctg
acggggcgcctccaccacaccgaggacgtgaagctggccatcaggaagaaacacgccccg
tccttcgccagactctgcctcgagagcacgtccctgtgcgacatgctgatgcacggcgtt
ccggagctgggcagggagatcggtcgcgggcagtacggcgtggtttacgccgtccgcggc
agctgggggggccactcgccggtcgcggtcaagtcggtgctgcccacggacgagcgccat
taccacgagctggccatggaattcttttatactaggagtataccggcgcacccccgcata
gtccgcctgtacgggtcgatagtacagcgccagagttctgggcccagcgtgctgctggtg
tccgagaggaaatgtcgggatctgcacgcggccgtcagggcgaaactccccttctccact
cggatgaggatcagctgcgatatcgtcgacggcatccgctacctgcactcgctgggtctg
gtgcaccgcgacatcaagacgaagaacgtcctcctggacggggcggaccgcgcggcgctg
tcggacctcggcttctgcacggccggcgcgctcatgtcgggctccgtggtgggcacgccg
gtgcacatggcgcccgagctgctggccggggactaccacgcctccgtcgacgtgtacgct
ttcgggatcttgttctggtacgtgtgcgctggtgacataaagctaccgtcagctttcgaa
actttccaaaacaaggaacagctttggagtaaggttaaaagaggtctgagacctgaacgt
ctacctcagttctcggacgagtgctgggagatcatggagtcgtgctgggcctccgagccc
tcccagcgggcgctcctcggggacgtgcagaacaagctggagaggatcttggagcaggct
ctaaaggacgaaaagtctcctggctacctcgccccggacgagccagaccttaacgacgac
tag

DBGET integrated database retrieval system