KEGG   Bombyx mori (domestic silkworm): 101741515Help
Entry
101741515         CDS       T02817                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmor01002]
    101741515
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101741515
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101741515
Peptidases [BR:bmor01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101741515
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101741515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_4 Abhydrolase_2 Peptidase_S9 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 101741515
NCBI-ProteinID: XP_012543774
Position
Un
AA seq 246 aa AA seqDB search
MVFGLLLATGASLTAGVLVFQVAVLPLMFRYNKTVQRKVVFSNCINFPRNLNYDSPSSCS
VTCGRNLNIEFRSIVDNFLIRLGTAVAANFVSNLEELCQERGSEKLRLPDALVLEAPFNN
LKDEIAKHPLSKLVSWLPYFKNTFVKPFTDSPDYSFTTDEYLAVVPDLPILMLHSKGDRV
VPYELAVKLQNKLVQSRKSSSAPFTFQTFEREHSIGHNNLCEAKHFKSAITDFLRLIEER
KKTKQD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtttttgggctcctcttagcgacgggcgcttcgctgacggccggcgtcctggtattc
caagttgccgtgctgcccctgatgttccgatacaataaaacggtccagaggaaagtggta
ttctctaattgcataaactttccgagaaacttgaactacgatagcccgtctagttgcagc
gttacatgcgggagaaacctcaacattgagttccgttcgatcgtggacaattttctcatc
agattaggaactgctgtcgcggcaaatttcgtatccaacttggaagagctgtgtcaagag
agaggctcagagaaactgaggcttcctgatgcgctggtcttggaggctcccttcaataat
ttgaaggacgaaatcgccaaacatcctctatcgaaactggtttcctggctgccctacttc
aagaatacgttcgtaaaaccgttcaccgattctcccgactattcgttcacgactgatgag
tatctcgccgtggttccggaccttccgattttgatgctacattcgaaaggggacagagtc
gttccctatgagttggcggttaagttacagaacaaattggtacagtccagaaaatcttcg
agcgctccgtttacttttcaaacttttgaaagagaacacagcattggtcacaataatctg
tgtgaagcaaaacattttaaatcagcaatcacggacttcctacggctcatagaagaaaga
aaaaaaactaaacaagactaa

DBGET integrated database retrieval system