KEGG   Bombyx mori (domestic silkworm): 101742228Help
Entry
101742228         CDS       T02817                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmor01001]
    101742228
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101742228
Protein kinases [BR:bmor01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101742228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101742228
NCBI-ProteinID: XP_004930857
Position
Un
AA seq 347 aa AA seqDB search
MSNFAKIVKTTPITDDYDISNTVLGLGINGKVLECQEKKSGLKRALKVLHDSVKARREVE
LHWRASGCKHIVEVIDVYENAYGGKTCLLVVMECMDGGELFQRIQDNRDGAFTERQAAEI
MHSICVAVRHLHDTNIAHRDIKPENLLYSSMEPNAVLKLTDFGFAKETLSPADTLQTPCY
TPYYVAPEVLGPEKYDKSCDIWSLGVVMYILLCGFPPFYSNHGLAISPGMKKRIRLGQYD
FPDPEWSSVSSEAKNLIRGMLSVDPAKRMTIQQVMSSPWVRQYTQVPQTPLYTNTLLREA
GDAWPDVQDEMTRSLATMRVDYDQVQIKALEQSNNSLLNKRRNKVGA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttcgcgaaaattgtcaaaactacgccgattacagatgattacgacatctca
aatacagtcctcggccttgggatcaatggaaaggttctagaatgccaagagaagaagtcc
ggcttgaagcgagcgctgaaggtgctacacgacagcgtgaaagcgagaagagaagttgaa
ctacactggagagctagtggatgcaaacacatagtggaggttatcgatgtatacgagaac
gcttacggcggcaagacctgtcttctagtcgtgatggaatgtatggacggtggcgagctg
ttccagaggatccaggataacagggacggtgccttcacggagagacaggccgcagagata
atgcactcgatctgtgttgccgtgaggcacctacacgacacgaacatcgcccaccgagac
atcaaacccgagaacctcttgtactcaagcatggagccgaatgcggtgctcaagctcacg
gactttggtttcgctaaggagaccttatcgccggcagacactctccagaccccatgctac
acgccctactacgtcgcgcccgaggtcttgggcccggagaagtacgacaagtcctgcgac
atctggtccctgggcgtcgtgatgtatatactgctgtgcggattcccaccgttctactcc
aaccatggtctcgccatatcgcctggcatgaaaaagcgaatccgtctgggccaatacgat
tttcctgatccggaatggtcgagcgtttcatcggaagcgaagaatctcatccggggaatg
ctctccgtcgatccagccaagaggatgaccatacagcaagtaatgtccagtccctgggtg
cggcagtacacccaggtcccgcagacgcccctctacacgaacacgctgctgcgtgaggcc
ggagacgcgtggcccgacgtccaggatgagatgacccgctccctcgccaccatgagggta
gactacgaccaggtgcaaataaaagctttggagcaaagcaataattcgttgttgaacaaa
cgccgcaacaaggtcggagcttga

DBGET integrated database retrieval system