KEGG   Bombyx mori (domestic silkworm): 101742528Help
Entry
101742528         CDS       T02817                                 

Definition
(RefSeq) fibrous sheath CABYR-binding protein-like
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 101742528
NCBI-ProteinID: XP_004923085
Position
Un
AA seq 1253 aa AA seqDB search
MDSHSRSASPRDRPQQRPPSPPSPHGYDNKVFQHDESDPNHNDSFASNGAQQNQLNGDTK
TLEAVNLELLNLAPKNGNAKKKDVEIDMNGTNPYDEYFVPVNEHRKFMRGEKLYVTADKR
GDKGGCKRPLCWTLLALVVAAIVALIVLAATGIGFSNSALENHLEQNTSISSARALGGLT
IPIAAEETNDTELHDNNVMNEEPSSDAEPTPEPEPAINDVQSRDAVPTPEPEPQPDTSIN
QEPSREAVPTPEPEPSISEEPSREAMPTPEPEPVISQEASREAVPTPEPEPSISEEPSRE
AMPTPEPEPSISQEPSRESMPTPEPEPPISQGPSKEAVPSSEPETPINHEPSRESMPTPE
PEPAINQEASTEAVPTPEPNPSINQGSYSNAEPTPEPEPAINEVASKDAVTTPEPEPSIN
QEQSIKMTPTVEQDLLIHQEPFKEAVQTTEQQPSINEEETTEPHFPINQEPSRDITLTIE
PESSANHETSKDVESVNKGESSETTTTVFEPTINHESSSEMVPTLEPKTSINEVRSEQTV
PDPETSLNKISSNEMVPTTVTQLELSQGPTRDVVTTLRPDMSMNDEQPIEIAQKIEPETS
INHELSRGMPHIIESEPTIDLESIIEPEPTIEPEPTIETEPTIETEPTIETESTIDKEPS
INQVLLSEMTPTSDPETVKEREMTPVISPELTINQEKSREMISTIEPERSINFEKTTEFQ
LSTNEKESREMTPTLTPQLNNEDVTRTQSMENQEQPGEAEPVIDLKTSITHELDTKTIST
TEPQLSTDREEHVEPPSSTNQERSREMAPETAQRSVKVVEVTKVQSPINQEQFREPAQTI
EPEPPTNAEETTEQLLSVNQEPFGETIPTIEPEPIDNEETTEQPSSINHASKDIVLTSEA
ELANQERSREQPNFSIDQKNTTELESPINQTETTEPQFSVSKQPSGEISAIPESVSSVNQ
EHTTEPQSSMDQEPSNEISATTKSQSSIDQEETTEQQISANQEEINDEDFLVNSDEENSP
GSSANEVETIETDSSLNEQKVKETTTESQSSYKQDLSTETSSTTELQPSEQKEETDDQHS
STNQVETTELETSVNQEQEPDLALTVEPLPSEIQEETTESHSSANQETSKEISSTTESQS
IVSQEPSVDVSLTVGPLTTTIREESTEEPKISKEVSLRNNTDNNVELTAEKPSENERSSK
IPQIQIYEVRPTDLPEIFSPATMHPPIKSPSFSNDREPTSTGLPFLEDMNDIY
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggatagccacagcagatcggcgtcgcctcgcgacaggccgcagcagaggccgccttcg
ccgccctccccacacggctacgacaacaaagtcttccagcacgacgaatccgatccaaac
cacaacgactccttcgcgtccaacggcgcgcaacagaaccaactcaacggagacacaaaa
acattagaggccgtcaatttagaattgttgaatttagcaccgaagaatggtaatgcgaaa
aagaaggatgtggagatagatatgaacggcacgaacccgtacgatgaatacttcgtgccc
gtcaacgaacacaggaagtttatgaggggtgaaaagttgtacgtgacggcggacaaacgt
ggcgataagggaggttgtaagcgacctctttgctggaccctgttggcgcttgttgtggcc
gctattgttgcactaatagtactggcagccaccggaataggattttcgaattctgcactg
gaaaatcatctcgaacaaaatacatcgattagttcagcgcgagctctgggcggcctcacc
atacctatagcggcagaagagacaaacgacactgaattacacgataataacgtgatgaat
gaggagccgtctagtgatgcagaaccaacaccagagccagaaccggcaatcaacgacgta
cagtcaagagacgcagtaccgaccccagagccagagccccagccagatacatcaataaac
caggaaccgtctagagaagcagtgccaacaccagagccggaaccatcaataagtgaggaa
ccgtctagggaagcaatgccaacaccagaaccagagccagtaataagccaggaggcgtct
agagaagcagtaccaacaccagagccggaaccatcaataagcgaggaaccatctagggaa
gcaatgccaacaccagaaccggagccatcaataagccaggaaccatccagagaatcaatg
cccacaccggagccggagccaccaataagccagggaccatccaaagaagcagtaccatca
tcagaaccagagacaccaataaaccatgaaccatccagggaatcaatgccaacaccagag
ccagaaccagcgataaaccaggaggcgtctacagaagcagtaccaacaccagagccgaac
ccatcaataaaccaggggtcatatagtaatgcagaaccaacaccagagccagaaccggca
ataaacgaagtagcatccaaagatgcagtcacaacaccagagcccgagccatcaataaac
caggaacaatctataaaaatgacaccgacagtagagcaagacttattaattcatcaggaa
ccatttaaagaggcggtgcaaacaactgaacaacaaccatcaataaacgaggaagaaaca
acagagccacatttcccaattaaccaagaaccatctagagacattacactaacgatcgag
ccagaatcatcagcaaaccatgaaacatctaaggacgtagaatctgtaaacaagggagaa
tctagtgaaacaacaacaacagtatttgaacctacaataaaccatgaatcatctagtgaa
atggtaccgacactggagccaaaaacatcaataaacgaagtgcgatctgaacaaacagtg
ccggatccagaaacatcattaaacaaaatatcttcaaatgaaatggtgcctacaacagtg
acacaattagaattaagccagggaccaactagagacgtagtgacaacattaaggccggat
atgtcaatgaatgatgaacagcctatagaaattgcacaaaaaatagagccagaaacgtca
ataaatcacgaattatctagaggaatgccacacataatagagtcagaaccgacaatagat
ctagagtcaatcatagagccagagccgacgatagagccagaaccgacaatagagacagag
ccaacgatagaaacagagccgacaatagaaacagagtcgacgatagacaaagaaccatca
ataaaccaggtgctattgagtgaaatgactccaacatcggacccagaaacagtaaaagag
agagaaatgacaccggtaataagcccagaactgacaataaaccaagaaaaatctagagaa
atgatatcgactatagagccagagcgatcaataaactttgaaaagacaacagagttccaa
ctatcaacaaatgagaaagaatcccgtgaaatgacaccaacattaacacctcaattaaac
aatgaagatgtaacaagaacacaatcgatggaaaatcaagaacaacctggggaagccgaa
ccagtaatagacctaaaaacatctataactcacgaattagatacaaaaacgatttcaaca
accgagccccaattatcaacagaccgcgaagaacacgtagaaccaccatcatcaacaaat
caagaacgttctagagaaatggcaccagaaacagcacagcgatcagttaaggtggtagaa
gtaaccaaagttcagtcaccaataaaccaggaacaatttagagaacccgcacaaacaata
gagcccgaaccgccaacaaacgctgaagaaacaacagagcaactactatcagtgaaccag
gaaccgtttggagaaacgatcccgaccatagaaccagaaccaattgataatgaagaaact
acagaacaaccatcgtcgataaatcacgcatccaaagatattgtattaacatctgaagca
gaactagcaaaccaagaacgatcgagagaacaaccgaacttttccattgaccagaaaaac
acaactgaactagaatcaccgattaatcaaacagaaacaacagaaccacaattttcagta
agcaaacagccatctggagaaatttcagcaataccagagtcagtttcatccgtaaatcag
gaacatacaacagaacctcaatcatcaatggatcaagaaccatctaacgaaatttcagca
acaacaaagtcacaatcatcaatagaccaagaagaaacaactgagcaacaaatatcagca
aaccaggaagagataaatgacgaagatttcttagtgaattctgatgaagaaaatagccca
ggctcgtcggcaaacgaagtagaaacaatagaaacggattcctcattaaatgagcaaaaa
gttaaagaaacaacaacagaatctcagtcatcatacaaacaagacctatctacagaaacg
tcatcaacaacagagctacaaccatcagaacaaaaggaagaaacagatgatcaacactca
tcaacaaaccaagttgaaacaacagaactagaaacatcagtaaatcaagaacaagaacca
gacctggcattgactgtggaaccgctgccatctgaaatccaagaagaaactacagagtca
cattcgtcagcaaaccaggaaacatccaaagaaatatcttcaacaacagaatcacaatct
attgtgagccaagaaccatctgtagatgtgtctttaaccgtggggccactgacaaccaca
atccgagaagaatcaacagaagaacctaaaatatctaaggaggtatcactgagaaacaat
acggacaataatgtagagctaacggcagaaaaaccaagcgaaaacgaacgatcgagtaaa
ataccacaaatacaaatttacgaagtgaggcccacagacttacctgaaattttctcgccg
gcaacaatgcacccgccaataaagtcgcccagcttttcaaacgatcgcgaacctacatca
acaggactaccatttttggaagacatgaatgatatttattag

DBGET integrated database retrieval system