KEGG   Bombyx mori (domestic silkworm): 101742651
Entry
101742651         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101742651
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB
Motif
Pfam: RVT_1 Exo_endo_phos_2 DUF2555
Other DBs
NCBI-GeneID: 101742651
NCBI-ProteinID: XP_012549585
Position
Un
AA seq 479 aa
MGDFNAKLGRRGDDELKVGPFGFGQRNPRGQMLADFMEKEGLFMMNSFFKKPPQRKWTWL
SPDGVTRNEIDFIMSTNRQIFNDVSVINSVKTGSDHRIVRGMLNINVRLERSRLMKSTLR
PSNAQIQNPESFQLELANRFEWLNSCASVDDVNSRLVETVRTVGSKFFKTHRKNRPQKLS
DRTRNLMASRRLMTLQTSEDAESYRQLNRHIMKSLRHDLRSFNTQRIKETIERNQGSKVF
ARDASIGQSQLTKLKTEDGRVTSNNVILFFKKGDKTLLKNYRPIALLSHVYKLFSRVITK
RLERRFDDFQPTEQAGFRKGYSTIDHIHTLRQIVQKTEEYNRPLCLAFVDYEKAFDSVET
WAVLRSLQRCRIDHRYIEVLKCLYNNATMSVRVQEHCTKEIPVKRGVRQGDVISPKLFIT
ALEDSFKLLEWQGLGININGEYITHLRFADDIVVMAESLKDLGRMLGDLRGFLNKWVLK
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgggagatttcaatgcaaaactgggccgtagaggcgatgatgagttgaaagtggggcca
tttggatttgggcagcggaatcccagaggacagatgctggcggactttatggagaaggaa
ggactctttatgatgaattctttcttcaagaagccgccacaacggaaatggacctggttg
agtcccgacggtgtaacaagaaatgaaattgacttcatcatgagcaccaacagacagata
ttcaacgatgtctctgtgatcaacagtgttaaaacaggaagtgatcaccgaatcgtcaga
ggcatgttgaatatcaatgtcagactggaaagatcgcgtctgatgaagtcaacgcttcga
ccgtcgaatgcacaaatccaaaaccccgagagctttcaactcgaattggctaatcgcttc
gaatggctaaacagctgcgcatcagtggacgatgtaaacagcaggctggtagagactgtc
cgtacggtagggtccaaatttttcaaaacccaccgtaagaatagacctcagaaactatcc
gaccgcacccgaaacctcatggctagtcgacgtttgatgacgctccaaacttcggaggac
gctgagtcatataggcaactcaatagacatatcatgaagtccttgcgacacgacctacgc
tcctttaatactcagcgtatcaaagagacgattgagcgaaaccaaggctctaaagtgttc
gcaagagacgcttctattgggcaaagccagctgacgaagctgaagaccgaagatggacgt
gtaacgtcgaataatgtgatcctgttcttcaaaaaaggtgacaaaaccttattgaagaac
tataggcccatagcactgctgagccatgtctacaagctgttctcgagagtcatcacgaag
cgtctcgaacgcaggtttgatgacttccagcctaccgaacaagccggtttccgaaaaggc
tacagtaccatagaccacatacatacgctgcggcagattgtacagaagaccgaagagtac
aatcggccattatgcttagcgtttgtggactatgagaaagcctttgattccgtcgaaaca
tgggcggtccttagatctctccagcggtgccgtattgaccaccggtacatcgaagtattg
aagtgtttgtataataacgccaccatgtcagtccgagtacaggagcattgcacgaaggaa
atccctgtaaagagaggagtgagacagggagatgtgatatctccgaaactgtttatcact
gctctggaggattccttcaaacttctggaatggcaaggacttggcatcaatattaacggc
gaatacatcactcatcttcggtttgccgatgacatcgtggtcatggcagagtcgctgaaa
gatttagggcgtatgctcggtgacctcagagggtttctcaacaagtgggtcttaaaatga

DBGET integrated database retrieval system