KEGG   Bombyx mori (domestic silkworm): 101742863Help
Entry
101742863         CDS       T02817                                 

Definition
(RefSeq) putative fatty acyl-CoA reductase CG5065
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    101742863
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101742863
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     101742863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sterile NAD_binding_4 DUF760 UL41A
Motif
Other DBs
NCBI-GeneID: 101742863
NCBI-ProteinID: XP_012552208
Position
Un
AA seq 332 aa AA seqDB search
MGKDLPVVIVRPPIGKYSRALFSKIAKVGTYKYVVTGHMYSLTPDLLCDDRSNPLYFPFS
VICTLNEPTPGWVDMSSVIGPSGVLLTLMLGVMHVVLTSDISIPIVPVDYVNNAVIATAS
DTNVRYNKNEKEIKVYNISCSGSKIETSCMSDFLKNPNTLEYATPKAVWYCYGFGTGSDV
VFWLSTWLLHYIPAYVADFVFNVTSMKRPEGIKSFVKLYEKIYKMSMLYGYFLRNQWNFV
DDNTVAMLNQMSKTDRILFNFDVAKIDCSRFMAIWCIGLRKFILKDGLKNSEYGRKKQSW
LKIANLCYHGLFFVTVIYFLYICCAMLMYVFR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggatttacctgtggtcatagtgaggccacccataggcaagtattcaagggct
cttttttccaaaatagctaaagtcgggacctataaatatgtagtaactggccacatgtat
agtttaacaccggacctcttatgtgacgatcgaagcaatccattatattttccgttttca
gttatctgcacgctcaatgaacccacacctggatgggtggatatgagctcggtgatcggt
ccaagcggggtacttttgacattaatgctaggcgttatgcacgtagttttaacgagtgat
attagcattccaatagtgcccgtggactacgtcaataatgcggtaatagcaacagcatcg
gataccaatgtacgttacaataagaatgaaaaagaaattaaagtttataatataagctgt
tctgggagcaaaattgaaacatcttgtatgtctgatttcctgaagaatcctaacacccta
gagtacgctacaccgaaagccgtttggtattgttatggttttgggaccggaagtgatgtt
gtattctggttgtcaacatggctattgcattacatacctgcatatgtagccgacttcgtg
tttaatgtgacctccatgaagcgacctgagggcataaagtcattcgttaaattgtatgaa
aagatatacaaaatgtctatgttgtacggctatttcctgaggaaccagtggaattttgtc
gatgacaacaccgtggccatgttgaaccaaatgtcaaaaactgacaggatattgttcaat
tttgatgttgcgaagatcgattgctcgcgttttatggcgatctggtgcatcggcttaaga
aagtttattttgaaggacggcctcaagaacagcgaatatggtaggaagaaacagagctgg
ttgaagatagctaatttatgttaccatggactattttttgtaaccgtaatttattttctg
tacatttgctgtgcaatgttgatgtacgtatttcgatga

DBGET integrated database retrieval system