KEGG   Bombyx mori (domestic silkworm): 101743113Help
Entry
101743113         CDS       T02817                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bmor01009]
    101743113
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     101743113
Protein phosphatases and associated proteins [BR:bmor01009]
 HAD phosphatases
  Other HAD phosphatases
   101743113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 101743113
NCBI-ProteinID: XP_004925985
Position
Un
AA seq 226 aa AA seqDB search
MDGTVLDSEVLYHKIIREICEKYGKDYTKDLQTRMTGTTDREICVTVVDLLKLPISVDEF
EKQLTDLAQKLLPSAPLLKGAKRLLTHLHDYKVPMALATNSTEQAVRLHALSRPKLFGMF
HHKVSVTDPEVKHGKPKPDIYLVAASRFPDKPKPIKCLVFEDSVVGVEAAIKAGMQVVMT
PGPRLQREHTRHATLVIKSLLDFKPELFGLPPFDKTLNKATEITNK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaccgtgcttgattctgaagtgttgtaccacaagatcatacgagaaatctgc
gaaaaatatggaaaagattacacgaaggatttacaaacgcgcatgaccggcaccacagat
agggaaatatgtgtgacggttgtggacttgttgaagttacctatatccgtggacgaattc
gagaagcagctcactgatttggctcaaaaattgttgccgagcgcacccttactgaaaggt
gccaaacgtctcctgacgcacctacacgattacaaggtgccaatggctttagctactaat
tcaactgaacaagcggtcagactccacgccttatctcgtccgaagttattcggaatgttt
catcacaaggttagcgttaccgatccagaggttaagcacggtaagccaaagccggacatt
tatttggttgccgcttcgagatttcccgacaagccgaaaccaattaaatgcctggtgttt
gaggattcggtggtcggtgtggaggccgccatcaaagctggaatgcaggtggtcatgacc
cctggacctcgtctgcagcgagagcacacccgtcacgccacgctcgtcatcaagtcactc
ctggacttcaaacccgaactcttcggtttgccgccctttgacaagactttgaataaagca
acagaaataaccaataaatga

DBGET integrated database retrieval system