KEGG   Bombyx mori (domestic silkworm): 101743310
Entry
101743310         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101743310
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB
Motif
Pfam: Helitron_like_N
Other DBs
NCBI-GeneID: 101743310
NCBI-ProteinID: XP_012545136
Position
Un
AA seq 2238 aa
MLTQNEAHVDANIQLLHDNYVEDATEDNHNNHENEIEIDREDRIGENIMDFIVDGTTPVY
TNYRKHSTSHIDFYKDFTSNSFGHSCIICDRLWWKRDLKMSTSKHESILKTILQNYTPGE
IVQVCYTCYTSLEKEKIPLMSTYNGFAYPKIPSHLPTLNLIEQRLISPRIPFMQIRRLRH
VNDQYGIYAQIINVPIEVDTMVKQLPRNIQDDHCFYVHLKKKLIHKTCHVHGLVNNSHIE
EWLSYLVSTPLYIYHDIKIDESFFTDNGCTSQLNMDEISEHVPIEDNLVAQQQTLLWNDD
YFLSLAPGEYNGISMDEHAEELSFPTIYGGQFRTYRDGVTVTPFMQATSELRRTDRRATD
PQHLLYIAAKIMRLRVSGCVNVAFKHVGQGTSITKETIESEEYINNCLETNLAFLRCIPN
SAWFWSDRKKDLFAMIRQLGPPTAFMGLSANETGWENLLKLLYKLKNEGAEISDKFLAEI
SYMYKAQLVNEDAVTCAIYFNKKVNCLLKVLQSKKRSPFGKHRVVHYFKRIEFQHLGSPH
AHILLWLENVPEDLLSNDPEVIKLIDELVSVSASEASGNIKLVTHKHTSTCYKKMNPNKK
QECRFGAPFMPTKKTVYLIPMKDTDPDYSEALFKEYKNRFKFIRNNLEYFDYTNFDEFYS
HNYIISDDHYYNIIRAGINRPKLFYKRTPAEKWHNSFNPFVLHHFKSNMDFQIILDEYAC
ATNVVEYANKHNRGISNLQRQIIDIMDEHPEFDIVDITNKVSIDILQSVEMSAQEAAWYL
LREPVAKSSVATVYIPTVLPTERARIRKSMKELETLDDDCTNVGKENWFDKYEKRPEELR
DVTLAQFVAKYYINKKGTYSKRDTARIIRYKNYDMAENYNDYRREMVLLHVPFQSEENDI
IAENKFIQIYEDNKDTILERKKEFESNLDIEKTLQICTQLCRENDEEQEDEELLGAAHDD
PIEIPDFNCIAQFNRDTVPKDILHNLALESSKHQKNHLLVLENQLLEEMKSSKELRGNMK
THFETNRFPWYKINRYHMKTVVLNKLKTLYAADDKSENVLAKDRMSQTDWIIFDFALVHE
KIDLIEKDGMRCQTQDRQPLIDLFELVTKFDIEDRSGDSLAGAWTAATALYNSRGRQCSP
MLLQKRWYQLKEVTRESLYEYWYASRENSPSSAESIQSATKLQRAVAQKYPSIITSAFPE
WRELIEKRLVIMSEDFEKENWMNNAEASIDTESKPDLQVIEPFIEMIDVDQDLDSETREH
GRRSEENTETNGMIIEIKSEPRDFEDLAEPLHTIKTPLLLYTGKTEQLTENETCNTDSGE
DVVKTDKNINITPTLDYLRETIEIVPKIAGVNGKVHDTHDSKDPTATKVCEDEAMLEEAT
KCHRDAINDVSNAVDIQERTLQDTNTLLKSEMEEHLHLNIFDNLIEFADNKVQSIENDHV
NTDSTMAESTSSEESSNELIVQVDYYHRHCSQLSASIATTKNVCVTENQASDLPSIAPGY
PKTAVERMREYRARKKKENQILNHSERKKSGAERVQECRARKKTKIQSAHSTMADSTSSE
KSSNEFIVQADVNHRHCSQLSASIATTNNVCVTENQASDLPSIAPGYPKTAAERMREYRA
RKKKENQILNHSKRKKSGAERAQECRARKKTKIQSAKSKPDLEVIEPFIETIDVDQDLDN
ETRKHRRRSEENTETNGVIIEIKSEPRDFEDLADPLQTIKIPLLLYTGKTEQLIKNETCN
TDSGEDVVKTDKNINIIPTLGYLRETIENSNEEKAKLIEEIVPKIAGVNGKVHDTHDSKD
LTATKVCEDEAMLEEATKCHRDAINDASNAVDTQERNLQDTNTILKSEMEEHLHLNIFDN
VIEFADNNFQSIENDHVNTAHVIQTKNDFTLRSQLSYKNGNSTPTFESKCFKRLFDLKED
EMKLSKNNPHACNENDSLKQLNISEIQTDVDKITNRNNFDISNTMNNTLFLESTSGAQSE
TRTDDSMKVKMSSHLFHKPRNRSYDPTQLCKNPDFNKKLKRLTDAFLSSPRNRVLLNACR
PITVDVMKAIESKLFNGTVYLKDCDQLNSNVPDHGAVSDTATRVPSTIASRSSTNIRLVN
PDHLMSLSKCYTLNLTQESCGDAMEINRKINQPDITEVPCSNQCWLTIEVPSLTVRTNNE
SIAATPELKSNLSCTEKETGISSKKKPRKELSVVNDCILTHDILNKMLVKMDEDEHNSSG
HFWYIISDTEVKHIKYHV
NT seq 6717 nt   +upstreamnt  +downstreamnt
atgctcacccaaaatgaagcccatgttgatgccaatattcaactattgcatgacaattat
gttgaagatgctaccgaagataaccataacaatcatgaaaatgaaattgagattgataga
gaagatcgaattggtgaaaatattatggattttattgttgatggtactactccagtttac
acaaattatcgtaaacacagcacaagtcatattgatttttataaagactttacgagtaat
tcatttggccattcttgtattatttgcgacagactatggtggaaaagagacttgaaaatg
tcgaccagtaaacatgagagtattttgaaaacaatcctgcagaattacacacctggtgaa
attgttcaagtctgctatacgtgttatacatctttggaaaaagaaaaaattcctctcatg
tcaacctacaatggttttgcatatccgaaaattccatcacatttaccaacgttaaacctt
atcgagcaacgattgatttcaccgagaataccgttcatgcaaattcgtaggctgagacac
gttaatgatcagtacggtatttacgcccagataattaatgttcctatcgaagtcgataca
atggtgaaacaattgccaagaaacattcaagacgaccattgcttttatgtgcatttgaaa
aagaagttgattcacaaaacttgtcatgtccacgggcttgtgaataatagtcatattgaa
gagtggttgtcgtatttagtatctacgcctctttatatttatcatgacattaaaatcgat
gaatccttttttaccgacaatggatgtacttcgcaattgaatatggacgaaataagtgaa
cacgtgccaattgaagacaatttagttgcgcagcaacaaactcttttgtggaatgatgat
tattttttgagtctagcacccggtgaatataacggtatttcaatggatgaacatgcggaa
gaattatcttttccgacaatctatggcggtcaatttcgaacatacagagatggtgttact
gttactccattcatgcaagctaccagcgaactccggcgtactgataggcgcgctactgac
ccacaacacctcttatacatcgctgctaaaatcatgaggttgcgagttagtggatgtgtc
aacgttgcgtttaagcatgtcggacaaggtacttcaattacgaaagagaccattgaatcc
gaagaatatataaataattgtttagaaacaaatctcgcattccttcgctgcataccaaat
tccgcttggttttggtcagatcgcaaaaaagatctttttgcaatgatcaggcaattagga
ccaccaactgcttttatgggtctaagcgccaatgaaacgggctgggaaaatttgttgaaa
ttattgtacaaattgaaaaacgagggggcggaaatttcagataagtttttagcagaaata
agttatatgtataaagctcaacttgtgaatgaagatgccgtaacttgtgctatttatttt
aataaaaaggtaaattgtctattaaaagttttgcaatcaaagaaaagaagtccattcgga
aaacatagagtagtacattatttcaaaagaatagaatttcaacatcttggtagcccacat
gcacatattcttctttggttggaaaatgttcctgaagatttattaagcaatgatcctgaa
gttattaaattaattgacgaattggtttctgtgtcagcgtcagaggcgtctggaaatata
aaactagtaacacacaaacacacatccacgtgttataaaaaaatgaatcccaataaaaag
caagaatgtagatttggtgcaccatttatgccaacaaaaaaaactgtttatttgatacct
atgaaagacactgatcccgattactcagaagcacttttcaaagaatataagaatcgattt
aaatttataagaaataatctcgaatattttgactacacgaattttgatgaattttactcg
cataattatattatttctgatgatcattactacaatattattcgtgctggtatcaataga
ccaaaattattctataaaagaacaccagcagaaaaatggcacaactctttcaatccgttc
gtattacatcattttaaatcgaacatggactttcagattatactagatgaatatgcttgt
gcaacaaatgttgttgaatatgccaataagcataatagagggattagtaatttgcaaaga
caaataattgacataatggacgagcatccagaattcgacattgtcgatatcacgaacaaa
gtgagtattgatatacttcagtctgttgaaatgtcggcacaagaagctgcttggtattta
ttaagagaacctgtggctaagtcatcggtggcgacagtctacattccaacggtattgcct
actgaacgcgcaagaattagaaaatctatgaaggaacttgaaactttagacgatgactgt
acgaacgttgggaaagagaattggttcgataagtacgagaaaagacctgaagagctccgc
gatgttacgttagcacaatttgttgcaaaatattacataaataaaaaggggacttacagt
aaaagagatactgcaagaataataagatataagaactacgatatggctgaaaattacaac
gattataggcgtgagatggttctgttgcatgttccatttcaaagtgaagaaaatgatatt
atcgctgaaaataagttcattcaaatatacgaggacaacaaagatacgatattagaacgt
aagaaagaatttgaatcaaatttggacatagagaaaactttacaaatttgtacacagttg
tgccgagaaaacgatgaagaacaagaagacgaagaattattaggagcggcgcatgatgat
ccgattgaaatacctgatttcaattgtattgctcaattcaatcgagatactgttccaaaa
gatattctacacaaccttgcattggaaagctctaaacatcaaaagaatcatttattggtt
ttggagaaccaactgttagaagaaatgaaatcaagtaaagaactcaggggaaatatgaag
actcattttgaaactaacagattcccgtggtataagattaacaggtaccacatgaaaact
gtagtactcaacaagctgaagacactttatgcggcagacgataagagtgaaaatgtattg
gctaaggaccgaatgtcccagacggattggattatatttgactttgctctcgtccatgag
aaaatagatctaattgaaaaagatggtatgagatgtcaaactcaggatcgtcagccgttg
attgatctcttcgagctggtgacgaagtttgacatagaggacaggtccggagacagtctg
gccggcgcctggactgcggccaccgccctctacaactcgaggggtcgtcagtgctcaccg
atgctactgcagaagcgttggtatcagctgaaggaggtgaccagggaatcgctatatgag
tactggtacgcctcccgcgagaactctccttcgtcggccgagtctatacaaagcgcaacc
aaattacagagagctgtggcccaaaaatacccgtcaataataaccagtgcgtttccggaa
tggcgggaactgatcgagaaaagacttgtaataatgtctgaagacttcgaaaaggagaat
tggatgaacaacgcggaagcttctatagacactgaatctaaaccagatttacaagtcatt
gaacctttcatagaaatgatagatgtggaccaagacttggacagcgaaacaagggagcac
gggagaagaagcgaagagaacactgaaaccaatggaatgattattgaaataaaatccgaa
cctagagattttgaagatctggctgagccattacacactatcaaaacaccattactttta
tacactgggaaaacagaacaattaaccgaaaatgaaacatgcaatactgattctggtgaa
gatgtggtgaagactgacaaaaatataaacattacccctactcttgattaccttcgcgag
acaatcgaaatagtaccgaaaattgccggtgtcaatggcaaggtgcatgatactcatgat
agtaaagatccaacagctacaaaagtatgtgaagatgaagcaatgcttgaagaagcaact
aaatgtcatcgagatgcaatcaacgatgtgtctaatgcagtagatatacaagaaagaacg
ttgcaagacacaaatacactattaaaatctgaaatggaagaacacttgcatttgaatatt
tttgataacctaatagaatttgctgataacaaagtccagtctattgaaaatgatcatgta
aatacagattcaacaatggcagaatccacaagttccgaggaatcttcaaatgaacttatt
gtacaagttgattactaccatcgtcattgttctcaactcagtgcatcaatcgcaactaca
aaaaatgtctgtgtgactgaaaatcaggcgagtgatcttccttcaatcgcccctggttac
ccaaaaacagctgtagaacgaatgagagagtatagagctcggaaaaagaaagaaaatcaa
atactgaatcattcagaacgtaaaaaatcaggcgcagagcgtgtgcaagagtgcagagcc
cgaaaaaaaactaaaatccaatcagcacattcaacaatggcagattccacaagttccgag
aaatcttcaaatgaatttattgtgcaagctgatgtcaatcatcgtcattgttctcaactc
agtgcatcaatcgcaactacaaacaatgtctgtgtgactgaaaatcaggcgagtgatctt
ccttcaatcgcccctggttacccaaaaacagctgcagaacgaatgagagagtatagagct
cggaaaaagaaagaaaatcaaatattgaatcattcaaaacgtaaaaaatcaggcgcagag
cgtgcgcaagagtgcagagcccgaaaaaaaactaaaatccaatcagcaaaatctaaacca
gacttagaagtcattgaacctttcatagaaacgatagatgtggaccaagatttggacaac
gaaacaaggaagcacaggagaagaagcgaagagaacacagaaaccaatggagtgattatt
gaaataaaatccgaacctagagattttgaagatcttgctgacccattacaaactatcaaa
ataccattacttttatacactgggaaaacagaacaattgatcaaaaatgaaacatgcaat
actgattctggtgaagatgtggtgaagactgacaaaaatataaacattatccctactctt
ggttaccttcgcgaaacaatcgaaaattcaaatgaagagaaagctaaattaattgaggaa
atagtaccgaaaattgccggtgtcaatggcaaggtgcatgatactcatgatagtaaagat
ctaacagctacaaaagtatgtgaagatgaagcaatgcttgaagaagcaactaaatgtcac
cgagatgcaatcaacgatgcgtctaatgcagtcgatacacaagaaagaaacttgcaagac
acaaatacaatattaaaatctgaaatggaagaacacttgcatttgaatatttttgataac
gtgatagaatttgctgacaacaatttccagtctattgaaaatgatcatgtaaatacagct
cacgttattcagaccaaaaacgatttcactttacgaagtcagttaagttataaaaatggc
aatagtacaccaacttttgaatcgaaatgtttcaagcgtctctttgatctgaaagaagat
gaaatgaaattgtcaaaaaacaatccgcacgcttgtaacgaaaatgacagtttaaaacaa
ctgaacatttcggaaatacaaactgatgttgataaaattacgaatcgaaataattttgac
atcagtaatacaatgaacaacactttgttcttagaaagtacatctggtgcacaaagcgaa
actagaacagacgatagtatgaaagtgaaaatgtctagtcacttatttcataaaccccga
aatcgatcgtatgatcctacacagctttgcaagaatccggactttaacaagaagttgaaa
agattaacggatgcattcttaagttcgccgcgtaacagggtactgctcaatgcttgcagg
ccgatcactgttgatgtaatgaaggcgattgaatccaaactgttcaacggtacagtgtac
ttgaaggactgcgaccaactgaactcgaatgttccagaccacggcgccgttagcgacact
gcgacgcgagttccttcaacaatcgcttcccggagctctacaaatattcgtttagtcaat
cctgatcatttaatgtcgctatcgaaatgttacacattgaatttaacacaagaaagttgt
ggtgatgcgatggagataaacaggaagatcaatcaaccagatataacagaagttccttgc
tcaaatcaatgttggctgacaattgaagtaccttccctgaccgtgcgaactaataatgaa
agtatagctgcaactccagaactcaagtcgaacctatcgtgtacagaaaaagaaaccggt
atttcgtccaaaaagaaaccaagaaaagaactttcagttgtgaacgattgtattcttacc
cacgacatcctcaacaaaatgttagtaaaaatggatgaagatgaacataattcttctggt
cacttttggtatatcatctcagatactgaagtcaaacacataaaataccatgtttaa

DBGET integrated database retrieval system