KEGG   Bombyx mori (domestic silkworm): 101744373Help
Entry
101744373         CDS       T02817                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00020  Citrate cycle (TCA cycle)
bmor00640  Propanoate metabolism
bmor01100  Metabolic pathways
bmor01200  Carbon metabolism
Module
bmor_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101744373
   00640 Propanoate metabolism
    101744373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101744373
Enzymes [BR:bmor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101744373
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101744373
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101744373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA
Motif
Other DBs
NCBI-GeneID: 101744373
NCBI-ProteinID: XP_004928485
Position
Un
AA seq 455 aa AA seqDB search
MAIVLPRSLGFAETILFRYGNKILTASSANKFPSKQQVRHLNVHEYISYTLLRDHGFLYP
NXCGQNQDEAIKFATELNTKDIVLKAQVLAGGRGKGTFKNGLKGGVRMVNTPEVAGDIAG
KMLKQLLVTKQTGAAGRICNMVMVTERKFPRREYYVAIMMERSFNGPVIIASSQGGVNIE
DVAAENPDAITYEPIDIVSGITDDQICRVIEKIGLQEFATEAHGMIKKMYDLFLKKDALL
IEVNPYAEDALTGQFFCLDAKFRFDDNAEFRQKELFSLRDTTQEDPKEIEAAKYNLNYIA
LDGNIGCMVNGAGLAMATMDIIKLYGGDPANFLDVGGGATAQAVSEAFKIILSDPKVTAI
LVNIFGGIMRCDVIAEGIINAAKNLNIQIPVIVRLQGTKVNEARKLVAESGLRIVPRDDL
DEAAKLAVQLSEIVALARKAGVEVKFDIPRVMLEK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgtattacctcgttctcttggttttgctgaaacaatattatttagatatgga
aataagatattgacagcatcttcagccaacaaatttccaagtaaacaacaagtccgccac
ttgaatgtacatgaatacataagttatactctactacgggaccatggattcctgtaccca
aattaatgtggccaaaaccaggatgaggcaattaagtttgccacagaactcaataccaaa
gacatcgttctaaaagcacaggttcttgctggtggtcgagggaaaggtacctttaagaat
ggacttaaaggtggagttcgaatggtcaacacacctgaagttgctggtgatatagcagga
aagatgcttaaacaactcctagtaacaaaacaaacaggggcagcaggacgaatttgcaac
atggtcatggtcacagagaggaagttcccacgcagggaatactacgtggcaattatgatg
gaacgcagtttcaatggtccagtcatcattgcttcatctcaaggtggtgtcaacattgaa
gatgttgcagctgaaaatcctgatgcaataacttatgaacctattgatattgtttcgggt
attactgatgatcaaatttgccgtgttatcgaaaagatcggtctacaagaatttgcaact
gaagctcatggtatgattaaaaaaatgtatgatttgttccttaagaaggatgccttattg
attgaagtaaatccgtatgccgaagatgccttgacaggacaattcttctgtttggatgcc
aagtttagatttgacgataatgctgaattcagacaaaaagagctatttagtttgagagac
actactcaagaagaccccaaggaaattgaagcagctaaatacaacttaaattacattgct
ctcgatggaaacattgggtgtatggttaacggtgctggattagctatggctacgatggat
ataatcaaactctacgggggtgaccccgctaacttcttggatgtcggtggaggcgctact
gcccaggctgtctctgaggcgttcaaaatcattctctcagacccgaaggtgacagctatt
ttggtgaacatttttggtggtattatgaggtgcgacgtcattgcagaaggtatcattaat
gctgccaaaaatctgaatatacagatcccagtgattgttcgccttcaaggaacgaaggtt
aacgaagctagaaagttggtagccgagtccgggcttcgcatcgtgcctcgcgacgacctg
gacgaggccgccaaactcgccgtgcaactctcagagatcgttgccctagccagaaaggct
ggagttgaggttaaatttgatattccaagagttatgcttgaaaagtaa

DBGET integrated database retrieval system