KEGG   Bombyx mori (domestic silkworm): 101744385
Entry
101744385         CDS       T02817                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase Dbp73D
  KO
K14807  ATP-dependent RNA helicase DDX51/DBP6 [EC:3.6.4.13]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bmor03009]
    101744385
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101744385
Ribosome biogenesis [BR:bmor03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    101744385
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 101744385
NCBI-ProteinID: XP_004932316
UniProt: H9IZG9
Position
Un
AA seq 607 aa
MDLFIINRYNDTNDDTHIIEQEAKRLEQLKQRIEERRKAFSVKKSSDVITLKEEKQTEIL
PDLPVSTNDDLPTEIPKPNTPPKPKEKIYAEKQKEFKVLGSSDFQKKSKVQRILPYWLSH
PTVVSRDLNELSCPVEEQEWLHPVIKSTLLSEGITKLFPVQNQVVPFILNEHTLPKLFQP
RDVCISAPTGSGKTLSFVIPIVQLLMKDVGCKIRALVVLPVQELAAQVAKVFKKYCNRTH
LKVALLSGSVPFQQEQQELVRFTESVGWVSKVEIIVCTAGRLVEHLKTTEGFNLQHLKFL
VIDEADRIMDNIQNDWLYHVDHHIKQGSELMTGKVQSLNWKNVSKQKLAPQKLLFSATLS
QDPEKLEQWGLFQPKLFSAATNECFEDEDQIRKYATPAELKEHYVVCEAENKPLVLYNFL
VEQKWDKVLCFTNAAETTHRLTVLLNTWACKGLKVAELSAALDRSMRENVLKKFMLSEID
VLISTDALARGIDIPDCNYVISYDPPRNIKTYIHRVGRTGRAGKIGKAVTVLLPSQISLF
KDLIKAGGKEEIPEIKINTDVIDRLFESYASAMNTTREKINSELNLKIKNSIEIKRSAKS
KIQKRKK
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggatttatttattattaacagatataatgacacaaatgatgatacacatataatagaa
caagaagcaaaacgcctagaacaattgaagcaaagaattgaagaacgtagaaaagcattt
tcagtaaaaaaatcgtctgatgtcattactttgaaagaagaaaaacaaactgaaatttta
cctgaccttcccgtttctactaatgatgatttgccaacggaaataccaaaaccaaataca
cctccaaaaccaaaagaaaaaatttatgctgaaaaacaaaaagaatttaaagttcttgga
tcaagtgactttcaaaaaaaatctaaggtgcagagaatattaccatactggctatcgcat
cctacagttgtatcaagagatttaaatgaactatcttgtccagttgaagaacaagaatgg
ctacacccagtaataaagtctactttattgagcgaaggcataacaaaactatttccagtt
caaaatcaagtggtaccattcattttaaatgagcatacattgccaaaattatttcaacct
cgtgacgtttgcatctcagcaccaacaggaagtggcaaaacactgtcatttgtcatacct
atagtgcagcttctaatgaaagatgtgggttgcaaaatacgagcacttgtggtattacca
gtacaagagttagctgctcaagttgctaaagtatttaagaagtattgcaatagaactcat
cttaaagttgctctcttgagtggttcagttccctttcaacaggaacagcaagagcttgtc
agatttactgaatcagtaggatgggtcagtaaagtagaaatcattgtatgtacagcagga
agattggttgagcacttaaagactacagaaggtttcaatttacaacatttaaagttttta
gttattgatgaagctgaccgaattatggataacatacaaaatgattggctctaccatgtt
gatcatcatatcaaacaagggagtgaattgatgacagggaaagttcagagtttaaattgg
aaaaatgtgagtaaacaaaaattagcaccccaaaaattactcttctctgccacattatcc
caagatccagagaagttggaacagtgggggctatttcaaccaaaattgttttctgctgcc
actaatgaatgttttgaagatgaagaccaaatcagaaaatatgctacacctgcagaactt
aaggaacactatgttgtatgtgaagcagagaacaaacctcttgtactttataatttttta
gtagaacaaaaatgggataaagtattatgttttacaaatgctgctgaaacaactcacagg
ctaactgtacttttaaacacatgggcttgtaaaggattaaaagtagctgaattgtcagcc
gctttagatagatcaatgagggaaaatgttttaaagaaattcatgctctctgaaattgat
gtgttaatcagcactgatgcattagccagaggtatcgatataccagattgcaactacgta
atatcttatgatcctccacggaacataaaaacatacatacatcgagttggtagaacagga
agagctggaaagattggtaaagcagtaactgtgctattgccaagtcaaatcagcttattt
aaggatcttataaaagcaggaggaaaagaggaaattccggaaattaaaattaatactgat
gtaattgatcgtttattcgaaagttatgcatctgccatgaacacaacgagagaaaaaata
aattcagagctaaacttgaaaattaaaaactcaatagaaattaaaagaagtgctaaaagt
aaaattcaaaagagaaaaaaatag

DBGET integrated database retrieval system