KEGG   Bombyx mori (domestic silkworm): 101744409Help
Entry
101744409         CDS       T02817                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1-like
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00051  Fructose and mannose metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    101744409
Enzymes [BR:bmor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     101744409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N pPIWI_RE_REase MAAL_C
Motif
Other DBs
NCBI-GeneID: 101744409
NCBI-ProteinID: XP_004927713
Position
Un
AA seq 457 aa AA seqDB search
MPAPNRDGLKIVDVDVKDVRFPTSLGGHGSDAVHTDPDYSCAYVIITTESGKRGYGLTFT
CGRGTEIIVFTIRSFKRFLLGKNASDIFADFAGFWRAITNESQMRWIGPEKGVTHLAVAA
IINSLWDLWARIENKPLWRLLSDMDPVELVSTIDFRYITDVITPEDAVELLRSKQAGKEE
RVEFLLENGYPCYTTQVGWLGYSDELVEELCDKYLKLGFTYFKVKVGRNFEDDYRRCSAV
RRYIGDDNVLMVDANQAWSVGQAIEWMKKLAPLKPMWIEEPTSPDDVLGHATISEALKPY
GIGVATGEMCANRVLFKQFLQSGGMQYCQIDAARIGGVNEILAVYLMAEKLKVKVCPHAG
GVGLCEMVQHLQFWDYASVSCTKEDRLIEYIDQQHEHFIDPCVVENAKYLAPQLPGYSTQ
FLQETLEKYTYPRGTEWEKMIKEGIFPQPDETEWANP
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctccaaatagagatggtctgaaaattgtagatgttgacgttaaggacgtacgt
ttccctacatcgcttggaggtcatggatctgacgctgtgcacacagatccagactactcc
tgcgcctacgtcatcataaccacagagagcggtaaacgcggctatggacttactttcacc
tgcggtagaggcactgagatcatagtcttcaccattagatcttttaaacgatttttgttg
ggcaagaacgcttcggacatttttgccgattttgctggattctggcgtgcgattaccaat
gaatcacaaatgagatggatcggtccagaaaagggagtaacccatttggcagttgcagcc
attattaactccttatgggacttgtgggcaagaatagaaaacaagccactgtggcgactt
ttgtctgacatggatcctgtggaattggtgtcaacaatagatttcagatacattaccgac
gtaataactccagaagatgcagtggaactactgagaagtaaacaagctgggaaagaagaa
agagtagaatttttgttagagaacggatatccgtgctatactacgcaagttggctggttg
ggttatagcgatgaattagtagaggagttatgtgataaatatctgaaacttggatttacc
tacttcaaagtgaaggttggtcgcaattttgaagatgactacagacgatgcagtgcagta
cgacggtatatcggggacgataatgttttgatggttgatgccaatcaagcctggagtgtg
ggccaagctatcgaatggatgaaaaagttggcgcctttgaagccaatgtggattgaagag
ccaacttctcctgatgacgtcttaggacatgcaacaatctcagaggccctaaaaccttat
ggtattggagtagccacaggcgaaatgtgcgccaatcgagtactttttaaacaattcctg
cagagcggcggtatgcagtactgtcaaatagacgcggccagaatcggtggtgtcaatgaa
atattagcggtgtatcttatggctgaaaaacttaaagtaaaagtatgtccacacgccgga
ggagttggtttgtgtgagatggtgcaacaccttcaattctgggattacgcgagcgtgtct
tgtacgaaggaggatcgcctcatagagtacattgatcaacaacacgagcattttatagat
ccatgtgtcgttgaaaatgcgaaatatttagcacctcaattacccggatacagcacacag
ttcctgcaagagactctcgaaaagtatacgtatccacgtggaacggaatgggaaaagatg
atcaaagaaggaattttccctcaacccgacgaaaccgaatgggcgaacccttaa

DBGET integrated database retrieval system