KEGG   Bombyx mori (domestic silkworm): 101744623Help
Entry
101744623         CDS       T02817                                 

Definition
(RefSeq) putative 1-phosphatidylinositol 3-phosphate 5-kinase
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00562  Inositol phosphate metabolism
bmor01100  Metabolic pathways
bmor04070  Phosphatidylinositol signaling system
bmor04145  Phagosome
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101744623
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101744623
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101744623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bmor04131]
    101744623
Enzymes [BR:bmor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     101744623
Membrane trafficking [BR:bmor04131]
 Endocytosis
  Macropinocytosis
   Kinases
    101744623
 Endosome - Golgi transport
  Others
   Others
    101744623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE DEP
Motif
Other DBs
NCBI-GeneID: 101744623
NCBI-ProteinID: XP_012550503
Position
Un
AA seq 509 aa AA seqDB search
MDKYDTSQLTEFPRFEPESTQSGVSTFFNKLLKFPIFSPSEASEVPQDKNAADNRDLTAS
AEQIKHEYDDNKAETGSYALELEGRSLPNVLRRITSLVALGSGNGTRYADTELARYWMPD
DISRECYECATRFSALRRRHHCRVCGQIFCSRCCSQRVPGHIFGCAGGLRVCNYCCNVVL
SYLKENDLTGDISPDLRTLQENLQMKFPEHKGQQLNKTREHFMFSHEQEERTEPRTTQKE
SLHDIFRQLSFTLPTQQHRYRLVRYNGVWRGCDIMQWIMDNTSNKTRAQATSVCQALLSA
GYVQGATPDPHFADYALYRPLAELPTLAHDQPPAEECTRIVESVSSYCLDLNLDDSSARL
IKTNKAEQRAPSSSEDETPAVEHNEEYNESSNVCRAIWCSGEEHLRLLLRQCAARRGLSA
AWLHVLLPLCQRAADLINLVLRRDYPHEVSKICSRDAAVVSPDGNVVDVDCSQTKYSLQN
SHKIEAIEIPQPEVHNHNRSETQLPSEGS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggataaatacgacacgtctcagctaactgaatttcctcgatttgagcccgaatccacc
cagagtggtgtgtcaacgtttttcaataaactattaaagtttccgatattctcgcctagt
gaggctagtgaagtgccccaagataaaaatgctgctgataatagagatttaaccgcgtct
gcagaacaaattaaacatgaatatgacgataataaggcggaaactgggtcatatgctctc
gagttggaggggcgtagtcttcctaatgtgttgagaagaataacaagtttagtagccctg
ggatctggtaacggcacaagatatgcagacactgaactagcccgatactggatgccagat
gatatttctcgtgaatgctatgagtgtgcaaccagattcagtgctttgagaagacgccac
cattgcagagtctgtggacagatcttttgctccaggtgctgcagtcaaagagttccaggc
catatattcggatgtgctggtggtctccgagtttgtaactactgttgtaacgttgtgctc
agctatttgaaagagaatgatctcactggagatatatcacctgatttgagaacactgcag
gaaaatctgcagatgaagttcccagaacacaaagggcagcagttgaacaagacccgtgaa
catttcatgttctctcacgagcaggaggaacgtacggaaccacgtacaactcagaaggag
tccttgcatgatatattcaggcaattatcttttacgttgcctacacaacaacatcgatat
cgattagtacgctacaacggagtgtggcgcggatgcgacataatgcaatggattatggac
aacaccagtaataaaacgagagcccaggcgacgagcgtgtgccaggcgctgctgagtgcg
ggctacgtgcagggcgcgactcccgaccctcactttgcagactacgcgctgtaccggccg
ctggccgaactaccgaccctcgcccacgaccagcccccggctgaagaatgcactcgaatc
gttgagagcgtgtcgtcttactgcctggatctaaatctagacgacagctcggcccggctc
atcaaaacaaataaagcagaacaacgggcgccttcttcgagcgaagacgaaactccagct
gttgaacacaatgaagagtacaatgaatcgagtaacgtatgtcgcgcgatttggtgctcc
ggcgaggaacacctccgactgctgctgcggcagtgcgcggcgcggcgcggcctctccgcg
gcctggctgcacgtgctgctgcccctgtgccaacgagccgccgacctcatcaatttagtt
ctccgacgcgattaccctcacgaagtttcgaagatatgctcacgcgacgccgctgtggtg
tcgcctgatggcaatgtggttgacgttgattgctcgcagactaaatactcattgcaaaat
tcgcataaaatcgaagctattgagataccacaaccagaagtacataaccacaaccgcagt
gagactcaattgccatcagaagggtcttaa

DBGET integrated database retrieval system