KEGG   Bombyx mori (domestic silkworm): 101744830Help
Entry
101744830         CDS       T02817                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bmor01009]
    101744830
Protein phosphatases and associated proteins [BR:bmor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101744830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8 RUN
Motif
Other DBs
NCBI-GeneID: 101744830
NCBI-ProteinID: XP_012543965
Position
Un
AA seq 340 aa AA seqDB search
MSQQDAHMTNNEADDVPITVSNGKENDERKDREGSASPPATPPPADEDTNEIILVNEETK
ELDLNHGRIGKIENLEHLKKLERLYLRWNLIKKIEGLEMLQSLVELELYDNQIVVIENLD
SLVNLEILDLSFNRIKEITGLEKLLNIKKLFLSSNKITEIKNVNHLPNLELLELGDNRIR
EIKNLEGLRTLKQLYLGKNKISKIQNLEDLTNLEILVLQANRLTKIENLEQLNKLDQLYI
SENGITAIENLENQTKLQTLDLAVNRITVIENVRHMSDLEELWLNDNQITEWSSIEYLQQ
NNKLSTIYLERNPIASDPAYRRKLKILLPTLHQIDATLCR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcaagatgcacatatgactaataacgaagcagatgatgtgcccataacagtg
agcaatgggaaagaaaatgatgaaaggaaggatcgggaagggtctgcctcaccaccggcg
acaccacctccggccgacgaggatactaacgagataattttagtcaacgaggagaccaag
gaactcgacttaaatcacggccgtataggcaagatcgagaatcttgaacatttaaaaaag
ctagagaggttatatttgagatggaatttgataaagaaaattgaaggcttagaaatgttg
cagtcactggtagaactggaattgtatgacaatcagattgttgttattgaaaaccttgat
agtcttgttaatttggaaatattagacctatcattcaataggataaaagagataacagga
ctcgaaaagctgctgaacatcaagaaattattcctcagctcaaacaagatcactgaaatc
aagaatgttaatcatttaccaaaccttgaacttttggagctgggcgataatagaattaga
gaaataaaaaacttggaaggtttgaggaccctcaaacaattatatttgggtaaaaataaa
ataagcaaaatacaaaaccttgaggatttgaccaacttggagatactggttcttcaggca
aacagattaactaaaattgaaaatctcgaacaattgaataaactagatcaactctatatc
tcagagaatggtataacagctatagaaaatttggagaatcaaacaaaacttcagaccttg
gatctggccgtgaacaggatcactgttatagaaaatgttcggcatatgagtgatttggag
gagctatggttaaacgacaatcaaataacagaatggtcatcgatagaatatttgcaacaa
aacaacaaattatccacaatatatttggagaggaacccgatagcttcagatccagcttac
agaaggaaattgaagatattgcttccaacactacaccagatcgacgcgacactgtgtaga
taa

DBGET integrated database retrieval system