KEGG   Bombyx mori (domestic silkworm): 101745118Help
Entry
101745118         CDS       T02817                                 

Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmor03016]
    101745118
Enzymes [BR:bmor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     101745118
Transfer RNA biogenesis [BR:bmor03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    101745118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 101745118
NCBI-ProteinID: XP_004922531
UniProt: H9J4G8
Position
Un
AA seq 714 aa AA seqDB search
MGRKNRNVNKFAQRKRDRKEQEKNPQEKPNGDNRKAYEDIVRENAAFEEYYKMQKICPEE
QWPVFMQTLKENLPTAFRITGSKGEADALMKIVNSDYFSQLLNIKLKIDGKDEEEEIKPV
NLPWYPGGFAWQLRLTRMDIRRNEALYRLHNFLVAETAAGGVSRQEQVSMIPPVVLDVKP
HHKVLDMCAAPGSKTAQLIEFLHADEDKMPTGFVMANDVDNSRCYMLVHQAKRLNSPCIV
ITNHDSAFMPSIEVTDEQDPSKTKPLKFDRILCDVPCSGDATLRKNPDIWLKWSTGNGNN
LHGVQYRILRRGCTLLAAGGRLVYSTCSFNPLENEAVLLRLLREAGGAVHLCDVTHMLPG
LEFAKGMTHWRPASKDMVFYDKYEDVPEKWQTVVRPQMFPPTAEEIEKYQLENCIRILPH
QQDTGGFFVAVLEKTASLPWEKEDADPQLEQPQEVKSAPPQKRRRMGGYREDPFVFFGND
EDVFPSIKSYYDLKDDFDPKCLLTRCHVGKKKNIYLVSPVVKDVVQRNERNIKIINTGVK
TFVRCDNKNMTCPFRLSQEGLLSIAQYIGPKRRIEILKDDLILVLQCDNPSNPPDIKLFS
EHTQNLVKDLATGSCVLEYRDRESKLELTLVGWRGVHSLRAYTAAPDAVHYLRILGADIS
KYDVNKFKVVENADAQTSETTETDVILNENLEEEVETIEEQKNTETTTTGCSEI
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaaaaaatcggaacgtcaacaaattcgcgcaaaggaaacgtgaccgcaaggag
caagagaaaaatccacaagagaaaccgaacggggataatcgaaaggcttatgaagatatt
gttcgagaaaatgccgcattcgaagaatactataagatgcaaaagatctgcccagaagag
cagtggccggtcttcatgcaaactctcaaagagaatctacctacggcattccgtatcaca
ggatctaagggcgaagctgacgctctaatgaagattgtgaacagtgattacttctcacag
cttctgaatataaaattgaaaattgatggaaaagatgaagaggaagaaattaagccagtt
aatttgccttggtaccctggaggttttgcatggcaattacggctcacccgtatggatatc
aggcgtaacgaggcattgtatcggcttcataactttcttgtagcagagacggcagcagga
ggagtctcgagacaagaacaggtgtcgatgatacctcccgtagtattagatgtgaaacct
caccataaggtgcttgacatgtgtgctgccccggggtctaagaccgcacaactcatagaa
ttcctacatgcagatgaagataaaatgcctacaggttttgtgatggcaaacgacgtagac
aacagccgatgctacatgttggtacatcaggccaagcgcctcaactcaccctgcatagtg
atcacgaaccacgactctgctttcatgccttccattgaagtaaccgatgaacaggatcca
agcaaaacaaagcccttgaagttcgaccggatattgtgcgacgtaccgtgctccggcgac
gcgacactacgcaagaacccggatatttggctcaagtggtccacgggcaacggcaataat
ttacacggcgtgcagtaccgcatactgcgacgcggctgcacgctgctcgcggcggggggc
cggctggtgtactccacgtgctccttcaaccccctggagaacgaggccgtgctgctgagg
ctgctgcgggaggccgggggcgccgtgcacctgtgtgacgtcacgcacatgctgcccgga
ctcgagttcgcgaaaggcatgacccactggcgcccagcctccaaggacatggtgttctac
gacaaatacgaggacgtaccagagaagtggcagaccgtggtcagacctcagatgttcccg
cccaccgctgaagaaatagagaagtaccaattagaaaattgcataaggatcctgccccac
cagcaggacaccggcggatttttcgtggctgttctagagaagaccgccagcctgccctgg
gagaaggaggacgctgatccgcagttagagcagccgcaggaggtcaagagtgctccgcca
cagaaacgcaggaggatgggcggctaccgggaggaccctttcgtgttcttcgggaatgat
gaagacgttttcccatcaatcaaatcgtactacgacctcaaagacgacttcgatcctaaa
tgcctgttgaccagatgtcacgtcggcaagaagaaaaatatatacctcgtgtcgccggtg
gtgaaggacgtggtgcagaggaacgaacggaatataaagatcatcaacaccggcgtgaag
accttcgtaaggtgtgacaacaagaatatgacgtgtccgttcagattgtcccaggaaggt
ctcctgagcatagcgcagtacatcggacctaaacgaagaatagagatactcaaagacgac
ttgatacttgtcctgcagtgcgacaaccccagcaacccgcccgatatcaaactcttctcg
gagcacacgcagaacctggtcaaagatttagccacaggcagctgcgtgctggagtaccgc
gatcgggaatcgaagctggaactgactctggtgggatggcgcggcgtgcactcgctgcgc
gcctacaccgccgcgccggacgccgtgcactacctccggatactaggagccgatatcagt
aaatacgacgtaaacaaattcaaagtggttgaaaacgctgatgcccaaacttcagaaact
acagaaactgatgtaatcctcaatgagaatctagaggaagaagtggaaactatcgaggaa
cagaaaaacacagagacgacaactacagggtgtagtgaaatataa

DBGET integrated database retrieval system