KEGG   Bombyx mori (domestic silkworm): 101745576Help
Entry
101745576         CDS       T02817                                 

Definition
(RefSeq) prostatic acid phosphatase-like
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101745576
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     101745576
    3.1.3.5  5'-nucleotidase
     101745576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Rox3
Motif
Other DBs
NCBI-GeneID: 101745576
NCBI-ProteinID: XP_004929231
UniProt: H9J9I3
Position
Un
AA seq 388 aa AA seqDB search
MKLFSTVWFLLVVSWCSESTPTRRLVEQNVVSDKSLQDTDLLLTFVVFRHGDRTPDQEEL
ALFPSSTQGNKDLFYPYGLKALTNMGKRRACSVGKYLRKNYDGFLSRLYLPDEIVIRTTD
YDRTKMTALTAMAGLYPPEPEQRWNPTLNWQPVPYNTPPRDEDDLLYYYNCPRYIALRDE
TASLPEIQDLLAPYKDLFQYLEQHTKTNITTSEDVFYLDNLFQTLRNVGVETPKWAQEVM
PQIKEVTKIEYAIQYYTPELIRLSAGVLLNEILNATASYLSGDTEQHKARLYSAHENNVA
AIMAAAKVFIPHQPNYGSTIAIEFRRNRTTGKYGFAAVYACDAGGPGKVLSVDGCGGEAF
CEYEKFVNLVQSYRITLEDFEYICPILT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattctcgactgtatggtttctgttagtcgttagttggtgctccgaaagtacg
cccacgagaaggctcgtcgagcagaatgtcgtgtctgacaagagtctacaggataccgat
ttgctcttaacgttcgtggtatttcgtcatggcgaccgtacaccggatcaagaagaactg
gcgttgtttccgtcatctacacagggcaataaggacttgttctacccttacggattgaag
gcattaacaaatatgggtaaacgtcgagcctgttcagtcgggaaatatctcagaaagaac
tatgatggattcctttcgaggttatacctaccagacgagattgttatccgcactacggat
tatgatcgcactaaaatgacagctttaactgcgatggccggattgtacccaccagagccg
gagcaacgatggaaccccacattaaactggcaacccgtcccatataacactccaccgcgc
gatgaagatgacttactatattactacaactgccctcgttatattgcactaagagatgaa
acagctagtttgccggaaatccaagatttattggcgccgtacaaagacctctttcaatat
ttagaacagcacacgaaaactaatattactacatcggaagatgttttttatttagacaat
ctatttcaaacactgagaaatgtcggcgttgaaacgccaaaatgggcacaggaagtgatg
ccgcaaataaaagaagttacaaaaatcgaatatgccattcagtattatactcccgaattg
ataagactatcagctggggttttgttaaacgaaatcttaaatgcgaccgcttcatatttg
tccggtgataccgagcaacataaagcacgtttgtattcggcacacgaaaacaatgtagcg
gcaataatggcagccgctaaagttttcatacctcatcagcctaattacgggtctacgata
gccattgaattccgaaggaatcgcactaccggaaaatatggtttcgcggcggtgtatgca
tgcgatgccggcggcccggggaaggtcctctccgtagacggatgcggcggagaagcgttt
tgtgaatacgaaaaattcgtcaatctagtccaatcttatagaattacattagaagatttt
gaatacatctgtccgatattaacttaa

DBGET integrated database retrieval system