KEGG   Bombyx mori (domestic silkworm): 101745777Help
Entry
101745777         CDS       T02817                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00350  Tyrosine metabolism
bmor00360  Phenylalanine metabolism
bmor00380  Tryptophan metabolism
bmor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101745777
   00360 Phenylalanine metabolism
    101745777
   00380 Tryptophan metabolism
    101745777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmor04147]
    101745777
Enzymes [BR:bmor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101745777
    4.1.1.105  L-tryptophan decarboxylase
     101745777
Exosome [BR:bmor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101745777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_5
Motif
Other DBs
NCBI-GeneID: 101745777
NCBI-ProteinID: XP_004931016
UniProt: H9J0C2
Position
Un
AA seq 500 aa AA seqDB search
MDANQFREFGRAVIDMLASYAENIRDYDVLPSVEPGYLLRALPESAPEQPEDWKDIMKDF
NQSIMPGVTHWQSPQFHAFYPSGSSFASIIGNMLSDGLAVVGFSWMASPACTELEVVTMN
WLGKLLDLPEEFLNCSSGPGGGVIQGSASEATLVGLLVAKDKTVRRFMNNNPDLDENEIK
AKLVAYTSDQCNSSVEKAGLLGSMKMKLLKADADGCLRGETLKRAIEEDKSQGLIPCYVV
ANLGTTGTCAFDPLHELGPICSEEDIWLHVDAAYAGAAFLCPEYRHLMKGIEHSQSFVTN
AHKWLPVNFDCSAMWVKNGYDITRAFDVQRIYLDDVKTTIKIPDYRHWQMPLGRRFRALK
LWTVMRIYGAEGLKTHIRQQIELAQYFAKLVRADERFVIGPEPTMALVCFRLKDGDTITR
QLLENITQKKKVFMVAGTHRDRYVIRFVICSRLTKKEDVDYSWSQIKKETDLIYSDKIHN
KAQIPALEQFTSRELCEKSK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaaccagtttcgggaattcggcagagcagtcatcgatatgttggcgagctac
gctgaaaacataagggattatgatgttctgccgtctgttgaacctggttacttgttaaga
gctctgcctgaaagtgcacccgaacaaccggaggattggaaagacataatgaaagatttc
aatcaatcaataatgccgggtgtaacacactggcaatctccgcagttccatgcattctat
ccttctggctcctcattcgcgagtattataggaaatatgcttagtgacggcttggcggtt
gtgggatttagttggatggctagccctgcgtgtacagaactggaggtggtcacgatgaat
tggcttggtaagctattagatttacctgaagaatttctaaattgctcttcgggtcccgga
ggcggagttattcaaggatcagcgagcgaagccaccttagttggattgcttgtagccaaa
gataaaactgttcgccgtttcatgaataataatccagatctcgatgaaaacgagataaaa
gcaaaacttgtagcttatacatccgaccaatgtaactcgtcagtagaaaaagccggctta
cttggttctatgaaaatgaaactgttgaaagcggatgctgatggatgcctacgcggagaa
acattgaaaagggcaatcgaagaagataagtcgcaaggacttataccctgctatgtcgtc
gctaatctgggaacaactggaacttgtgcattcgatcctttacatgaattagggccaata
tgtagtgaggaagatatatggcttcacgtagatgcagcctatgcgggagcagcatttttg
tgtcctgaatacagacacctaatgaaaggtattgaacattctcaatcgttcgtaacgaat
gcacataagtggctaccggttaatttcgattgctctgctatgtgggttaaaaatggttat
gatataacgagagcattcgatgtacaaagaatttatttggatgatgtaaaaacgacaatc
aagatcccagattacagacactggcaaatgccactaggccgtcgctttagagccttaaaa
ttgtggacagttatgagaatttatggtgctgaaggtttgaaaacgcatatcagacagcaa
atagaattagcacagtattttgcaaaactggtacgtgcggacgaacgttttgtgattggg
cccgaaccgactatggcattggtctgttttagactgaaagacggtgacacaattacgcga
caattgttggaaaatataacgcaaaaaaagaaagtgtttatggtggccggaacgcacagg
gatagatacgtcattagattcgtgatctgctcccgattgactaagaaggaagacgtcgat
tacagctggagccaaataaagaaagaaaccgacctcatctattcagataaaatacacaat
aaagcacaaataccagctcttgaacaattcacttcaagagaactatgcgaaaaatctaag
taa

DBGET integrated database retrieval system