KEGG   Bombyx mori (domestic silkworm): 101746070
Entry
101746070         CDS       T02817                                 

Definition
(RefSeq) protein spinster
  KO
K23677  MFS transporter, Spinster family, sphingosine-1-phosphate transporter
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmor02000]
    101746070
Transporters [BR:bmor02000]
 Major facilitator superfamily (MFS)
  Lipid transporters
   Sphingosine-1-phosphate transporter (Spinster) family [TC:2.A.1.49]
    101746070
SSDB
Motif
Pfam: MFS_1 OATP Sugar_tr
Other DBs
NCBI-GeneID: 101746070
NCBI-ProteinID: XP_004932106
Position
Un
AA seq 501 aa
MDPRGITPNTSNQQLVINGDNDSATALLQEKQARRHNSLREVTFSQYMTVSILCFVNLIN
YMDRLTIAGVLNNVKTEFEIGDGKAGFLQTVFVVAYMLFAPIFGYLGDRYSRRVIMASGV
ALWSLTTFFGSFLHDYESFAFFRGLVGIGEASYSTIAPTIISDLFVGDVRSKMLAFFYFA
IPVGSGLGYIVGSVVGAALGNWRYGLRVTPFFGAIAVALIIWVMEDPERGASEESHIKPT
SYKDDLRALIKNPSFMLSTIAFTCVAFVTGALTWWGPQVIYLGLGLQPGNEFSFERVSLT
FGAITMVSGMLGVPLGAWLGAGLQKRWGRAHPLLCGAGLLLSAPAVALALLLTEGYMYAP
FALIFIGELAININWAIVADMSLYVVIPPRRSTAEAFQILISHMFGDAGSPYLVGVISES
LKSYLMPSPDDLPSKTVEFRALQYALFITCFVEVLGGIFFLITSAYIVRDKLKVDRAIAE
AEAQHTEPSHASAHEDIVAGE
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaccctcgtggtataacaccgaacacttcgaaccaacagttagttataaacggtgat
aatgattcggcgacggcacttctacaggagaaacaggcgagaagacataacagtctacgt
gaagtgaccttctcacaatatatgactgtctctatattatgcttcgttaacctcatcaac
tacatggacagattgactatcgccggtgttttaaataatgtcaaaactgaattcgaaatt
ggtgatggcaaggctggatttctacagacagtgttcgtcgtcgcgtacatgttgttcgcg
ccaatatttggctacttaggagatagatactcaaggcgcgtcattatggccagtggcgtt
gcgctctggagtctaacaactttctttggctcgtttttacacgattacgagtcgtttgca
ttcttccgtggtctcgttggaattggagaagcctcgtactccacgatagcccctaccatc
atcagcgatctcttcgtgggggatgtaagatcgaagatgttagcattcttctattttgcc
atcccagtcggaagtggtctcggatatatagtagggtcagttgtgggtgcagcgctaggc
aattggcgatacggtctacgggtgacgcctttctttggcgcgattgccgtcgcgctcatc
atatgggtcatggaagacccggaacgaggcgcctccgaagagagtcacataaaacccact
tcgtataaggacgatctgcgtgctctcataaaaaatccatcgttcatgctgtcgacgatc
gcttttacatgcgtagcgttcgtgaccggcgcgctcacgtggtggggaccgcaagttatt
tacttgggtctcggcttgcaacctggcaacgagttttccttcgaaagggtttcgctaacg
ttcggcgcgatcaccatggtgtcgggcatgttgggcgtgccgctgggcgcgtggctgggc
gcggggctgcagaagcggtggggccgcgcgcacccgctgctgtgcggcgcggggctgctg
ctgtcggcgccggcggtcgcgctcgccttgcttctgaccgagggctacatgtacgcccct
ttcgccctcatatttatcggcgagctcgcgatcaatatcaactgggcaatcgtggccgac
atgtcgctgtacgttgtcataccaccaaggcgttcgacagcagaagctttccagatatta
atatcgcacatgtttggggatgctggaagtccgtacttagtcggagttatatcagaaagt
ttgaagtcctacttgatgccatcaccggatgatttgccaagtaaaactgtagaattcaga
gcgcttcagtatgcgctgttcataacgtgcttcgtggaagtactcggaggaatattcttc
cttataacatcggcgtacattgtcagggacaaactaaaagtggacagagctattgcagaa
gcagaagcacagcacacggagccgtcccacgcttcagcacacgaagacattgtagccggc
gaatag

DBGET integrated database retrieval system