KEGG   Bombyx mori (domestic silkworm): 101746400Help
Entry
101746400         CDS       T02817                                 

Definition
(RefSeq) ATP-dependent RNA helicase DDX18-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bmor03041]
    101746400
   03009 Ribosome biogenesis [BR:bmor03009]
    101746400
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101746400
Spliceosome [BR:bmor03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    101746400
Ribosome biogenesis [BR:bmor03009]
 Eukaryotic type
  90S particles
   Helicases
    101746400
  Pre-60S particles
    101746400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII CMS1 SNF2_N
Motif
Other DBs
NCBI-GeneID: 101746400
NCBI-ProteinID: XP_004930677
Position
Un
AA seq 467 aa AA seqDB search
MSANDIYPKCTFSMLKGKIDCRILSTLRQMGFQRPTRIQAQAMPYLLQQKDLIGAAKTGS
GKTLAFLIPAVDQLIKLGFTLKHGTGCIILSPTRELALQTFEVLKRLLTDIDISHCLIVG
GEKKNKDVSKLQKGMNIVVSTPGRLLDHLQTTNTFNCKNLKCLIIDEADKLLESGFEKHV
NGILEKLPNDKQTVLFSATIDDRVKNLARLALRSDPIWITVDDDAKRSTVSGLQQGYYIC
PVEKRMAWLYKMLKKCKKLKVMVFFSSCKSVDFHYEFFRVNCKAIVSSIHGRQSQAKRKE
AYHGFVEAQNGALFCTDVAARGLDIPSVDWIVQYDPPTDPKEYIHRVGRTARGMNSKGNA
VILLRPEEEEFVKFLENEKVYLDKYTFGDPPADIQEFLQKLIKENGVMKVLARKAFLSFL
RCYKNHPLKSIFNIKNLNLQLASKAFGFDETPHVDFCILFWHLPTLG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaacgatatttatcctaagtgtacattttccatgctcaaaggtaaaatcgac
tgtagaattctttctacgttaagacaaatggggtttcaaagacctacacgtatccaagct
caggcaatgccctatttattacaacagaaggaccttataggtgcagctaaaacaggaagt
ggaaaaacattagctttcttaatacctgctgtagatcaacttattaaacttggatttaca
ctaaaacatggtacaggttgcatcattctatctccaacaagagaattagctctgcagaca
tttgaagtactaaagagactcttgacagatattgatatttcacattgcttgattgttgga
ggtgagaaaaaaaataaggatgtgtccaagctacaaaaaggcatgaatattgtagtgagt
actcctggaagacttcttgatcatttacaaaccacaaacacatttaattgcaaaaatctg
aaatgtcttataattgatgaagctgataaactgttagaatctggctttgaaaagcatgta
aatggaatactggaaaaacttccaaatgataaacaaaccgttctttttagtgcaacgatt
gatgatagagttaagaatctagctagactggcgttgaggagcgatccgatctggataact
gttgatgatgacgcaaagcggtccactgtctctggattgcaacaggggtactacatttgc
ccagtagaaaaaagaatggcttggttgtacaagatgttgaagaagtgcaagaaactgaaa
gtcatggtgtttttctcatcgtgtaaatcggtcgattttcattatgaattctttagagtg
aattgtaaggcaatcgtctctagtatacacggcagacaaagccaggccaaaagaaaagaa
gcctatcacggtttcgtggaagcacaaaacggtgcgttgttctgtaccgatgtcgccgcg
agaggactggacataccgagcgtcgattggattgtccaatacgaccctcccactgaccct
aaggagtacatacatagagttggacgtaccgcccgaggtatgaacagcaaaggcaatgca
gtgatattacttagaccagaggaagaggaattcgtgaagttcttagagaacgaaaaagtt
tatttagataaatacacttttggcgatcccccggcagacatacaagaatttcttcaaaaa
ctaataaaagagaacggagttatgaaagttttggcgagaaaagcttttctttcgttttta
cgttgttataaaaatcatccactgaagagtatttttaatatcaaaaatctgaatctacag
ttggcatcaaaagcctttggatttgatgaaacgcctcatgtcgatttctgtatccttttt
tggcatttacctaccttgggttga

DBGET integrated database retrieval system