KEGG   Bombyx mori (domestic silkworm): 101746660Help
Entry
101746660         CDS       T02817                                 

Definition
(RefSeq) solute carrier family 41 member 1-like
  KO
K15122  solute carrier family 41
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmor02000]
    101746660
Transporters [BR:bmor02000]
 Solute carrier family (SLC)
  SLC41: MgtE-like magnesium transporter
   101746660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MgtE
Motif
Other DBs
NCBI-GeneID: 101746660
NCBI-ProteinID: XP_012545727
Position
Un
AA seq 456 aa AA seqDB search
MVVPVDVTRSTEKNDDQTPYLNDNPVFTIRDETGIPDNHYSMASINSCGELKSPGDPEKK
IPDTDAEKQPLSGKKEEKWWTTLMQVAVPFFIAGCGTIGAGLVLGTVRDWDVFINISAIF
VLVPSLSGLKGNLDMCLASRLSTQANLGNMDSTKEVISMVVGNISLVQVQAIVAATVVSI
FAIVVNTITDRAIFGPYVLLLVACAVFTATTTCFVLDFVMVMVIYASHRFKVNPDNVATP
LAASIGDIVSNTVLAVTAQYMYEQIQVSLWQPIALICVYYSLLPLWVFIVWRNKYTKTVL
TSGWTPVISALFISGIGGIVLDQAVDYFRGYEVFQPIVNGIGGNLVCVQSSRLATHLHQT
AIPGILPENTKIIEWPWKTLFFGTTAANVARMLLILAVFGQIIFMVVADFVYQGTVTIQF
AFGITYLTCALLQVHSPGSNSFALSYTFKRVNVPSE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggttgttccagtagatgtcaccagatcaaccgagaagaacgacgaccaaacgccatac
ctcaatgacaaccccgtcttcactatcagagatgagacaggtatccctgataaccactac
agcatggcgtcgataaacagctgcggggaattgaagagtcccggggacccagagaaaaag
atcccggataccgacgctgagaaacaaccgctttccgggaaaaaagaagaaaaatggtgg
accacattgatgcaggtagctgtacccttctttatagctggctgcggtaccatcggagct
ggtttggtgctcggcacagttagggattgggatgtttttataaacatatcggccattttc
gttcttgtgccctcactgtcaggactaaagggtaacctggacatgtgtctcgcatctcga
ctgtcaacgcaggcgaatttgggcaacatggactccacgaaggaggtcatctcgatggtc
gttggaaacatatcattggttcaggttcaagctatagtggctgcgactgtggtctctata
ttcgccatcgtggtgaacacgatcacggaccgcgccatcttcgggccctacgtcctcctg
ctagtcgcgtgcgccgtcttcactgctacgaccacttgctttgtgttggatttcgtgatg
gtaatggtgatatacgcgtcgcacaggttcaaggtgaacccggacaacgtggcgactccg
ctggcggcctccatcggggacatcgtcagcaatacggtgctagcggtcaccgcccagtac
atgtacgagcagatccaggtgtctctgtggcagcccatcgcgttgatctgcgtgtactac
agcctcctcccgctctgggtgttcatcgtctggaggaacaagtacaccaagaccgtcctc
accagcggctggacccccgtcatctccgccctgttcataagcggtatcggcggtatagtc
ctggaccaggccgtcgattacttccgagggtacgaggtgttccagccgatcgtgaatgga
atcggggggaacctggtgtgcgtgcagtcgtcccggctggccacgcacctccaccagacc
gccatccccgggatcctgccggagaacactaagatcattgagtggccttggaagactttg
ttctttggaacgaccgcggcgaacgtggctcgcatgctgctgatcctggccgtcttcggg
cagataatcttcatggtggtcgcggacttcgtgtaccaggggacggtcaccatccagttc
gcgttcggcatcacgtacctcacgtgcgccctgctgcaggtacactcgccagggtcaaac
tcttttgctttatcttatacctttaaacgagttaacgtgccgtccgagtga

DBGET integrated database retrieval system