KEGG   Bombyx mori (domestic silkworm): 101746900Help
Entry
101746900         CDS       T02817                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bmor03021]
    101746900
Transcription machinery [BR:bmor03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101746900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 101746900
NCBI-ProteinID: XP_004926355
Position
Un
AA seq 702 aa AA seqDB search
MDVDTDGRKSRSRSRSVDSEMSHDGSTHSRKKSRSKSRSRSRSISHSPSKSRSRSGSHTS
SRSKSGSPARSRSSSPAKSRSRSGSPAKSRSRSGSPAKSRSRSSSHAKSRTRSESRAEAR
SRSGSLKSRSRSRSGSRSKFNSASQRTSRSVTPKVDKRDNRSKSDSPANLEIDEDATSAR
RSRSGSKERRSRSKSAERQRKSRSHSRSQPRKSRSRSHSKSRSRSKSRSKSHSHSKSRSK
SHSHSKSRSKSHSHSKSRSKSRSRSKSRSKSRSRSKSHSRSKSHSRSKSRSKSRSRSKSR
SKSLIKSRSRSKSRSRSKSRSVSRSRSRSRSGSKSVRSRSQSRSSSRSGSGSPSRRGKKR
RAVRLDSDDEGEPKRARDEGDEAPEVEGEGRVLDAEAAQPDSSDDDIAPDSKSAEAAGGL
SDFEVMLARKRDERRGRRRRRDIDIINDNDDLIAQLLQSMRQAADEDRELNRKNQPAVKK
VSMLKTAMSQLIKKDLQLAFLEHNALNVLCDWLAPMPNRALPCLLIRETVLKLLTDFPPI
DKSLLKQSGIGKAVMYLYKHPKETKANRERAGRLISEWARPIFNLSTDFKAMTREERQAR
DEAMAGGRRRDDPGPSASAQDEPRARRPGEAGWVARARVPQPSTKDYVYRPKSTCDLDMS
RTTKKKMTRYEKQMKKFVDQKRLKSGSRRAVEISIEGRKMAL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgatacagatggcaggaagtctcgatcccgtagtagatctgtggattcagaa
atgtctcatgatggttccacacactcaagaaaaaaatccagatcaaaatctcgttctcgg
tcccgcagcatatcacattctccctccaagtccagatctagaagtgggtcacatacgtct
tcacgctcaaagtctggctcgccggctcgttctagaagcagtagccctgcaaagtctagg
tcccgaagtgggtcaccggctaaatcaagatctcgtagtggatcacctgcgaaatctaga
tcccgaagtagttcccatgcgaaaagtcgtactcggagcgaatcgcgggccgaggctcgt
tctagaagcggctcgttaaagtctcgcagcagatcacgaagcggttcgagatctaagttc
aatagcgcttcccaaagaacatctcgcagcgtcaccccaaaagttgacaagagagacaac
agaagcaagtcagactcccctgccaacttagagattgatgaagatgcaaccagcgcgagg
agatcgcgcagtggctctaaagaaaggagatcaagatccaaatctgctgagcggcaaaga
aaaagtaggtcacattcgaggtcccagccacgaaaatcacgatctcgttcgcattccaaa
tcgcgttctcgctctaaatcccgctccaaatctcattctcactctaaatcccgctccaaa
tctcattctcactctaaatcccgctccaaatctcattctcactctaaatcccgctccaaa
tcgcgctctcgttctaaatcccgctccaaatcgcgttctcgctccaaatcccattctcgc
tccaaatcccattctcgctctaaatcccgctccaagtcccgttctcgctctaaatcccga
tccaaatctctcattaaatctcgttcgagatcgaagtctaggtctcgttccaagtctcgc
tccgtgtctcgatcgcgctcgaggtcgcgctccggctccaagtcagtgcggtcaaggtcc
caatcaaggtccagttctcgttccggctccgggtcgccctcgcgcaggggtaaaaaacgg
cgagctgttcgactcgattctgatgatgaaggagagcccaagcgagcccgagacgaggga
gacgaggcgcccgaggtggaaggggaggggcgcgtgctggacgcggaagcagcgcagccc
gacagctccgacgatgacatcgcacccgactctaagagtgcggaggcggcgggcgggctg
tctgacttcgaggtgatgttggcgcgcaagcgggacgagcggcgaggccggcggcggcgc
agggacatcgacatcatcaacgacaacgacgacctcatcgcgcagctgctgcagtccatg
aggcaggcggccgacgaggacagggagctcaatcgcaagaaccaacccgccgtgaagaag
gtgtccatgctgaagacggccatgtcgcagctgatcaagaaggacctgcagctggccttc
ctggagcacaacgcgctcaacgtgctgtgcgactggctcgcgcccatgcccaaccgcgcg
ctgccctgcctgctcatccgcgagaccgtgctcaagctgctcaccgactttccgcccata
gacaagtcgttgctgaagcagtccggcatcggcaaggccgtgatgtacctctacaagcac
cccaaggagaccaaggccaacagagagcgagccggccgactcatctccgagtgggccagg
cccatcttcaacctctccacagattttaaagccatgacgcgggaagagcgacaggcacga
gatgaagccatggcgggcgggcggcggcgggatgaccccggaccctccgccagcgcgcaa
gacgaacccagggcgcggcggccgggcgaggcgggctgggtggcgcgcgcgcgggtgccg
cagccctccaccaaggactacgtgtaccgacccaagtccacctgcgacctggacatgtcc
cggaccactaagaagaagatgacccgctacgagaagcaaatgaagaagttcgtggatcag
aagcgactgaagagcggctcgcggcgcgcggtcgagatctccatcgagggccgcaagatg
gcgctgtga

DBGET integrated database retrieval system