KEGG   Bombyx mori (domestic silkworm): 105841773Help
Entry
105841773         CDS       T02817                                 

Definition
(RefSeq) serine/arginine repetitive matrix protein 1-like
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC KASH_CCD zf-CCHC_2
Motif
Other DBs
NCBI-GeneID: 105841773
NCBI-ProteinID: XP_012546693
Position
Un
AA seq 632 aa AA seqDB search
MPPPKGRPARRRGAPSPAPSSVSMSVASLDGQTTEEEEGGLQDPALVIDRAMKTIKSYAA
NGTKTKAAGRKLREVVSQVSKVLPSVASANDQVVQLMAENSRLRAQLQAQQQPNDGAATP
WATGAPRGPRPPALTGDRWPVLPPPRVAQQRPRLPSPRSRETSAAERRRALAGPRMLAPP
EPANFSLDEVISRTVQAVIERLGGRLAALEAKVSVSADTRRLAVSGALATRPAPVRAPAT
KSGPGRAKTKRGGGAIANPPLQAPQSRPLPPPPSNMDEGWNVVARRGTRKAPPAAPQMGR
APAAKAAQAAPQQGRASEAAKKNQKKKLPRAPRSAAVVLTLLPAAEAKGMTYRDVIARAR
AAVDLGEIGAEEGLRCRQTANGAKLLECPVADSAGIAERLVAKLRMVLPEEEVRVHRPVK
MAELRVTGLDDCTTRDEVMAAVAVQGKCALENVTVGEPRRGYTGASSVWVRCPVEAAASL
AAPPPGRPSGNPGILRVGWIAAHVRLLESRAWRCLRCFSTGHGFARCTSSVDRSGLCFRC
GQPGHKAASCTAAPHCALCAAAGRRANHRAGGKACFPSGVNTERNRRRKSRRRQKRRLAR
GALANVAIPAAAPVPEGGGSGEEEGAMDVVQQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgccgccccctaaagggagacccgcccgtagaagaggcgcaccgtcaccggcaccatca
tcagtgtcgatgtctgtcgcctcactagacgggcagacgacggaggaggaagagggtggt
cttcaggaccctgccttggtcatagacagggccatgaagaccatcaaatcatatgcggcc
aacggcaccaaaaccaaagctgctggccgaaaactgcgagaagtggtctcgcaggtctcg
aaggttctgccttcggttgcttctgccaatgaccaggtagtacagctgatggcggaaaat
tcgaggcttcgagcacagcttcaagcacagcagcaacccaatgacggcgcagcgacgcct
tgggctactggagcccctcggggcccccgtcccccggcgctgactggcgaccgatggcct
gtgctgccaccaccgcgtgtggcacaacagcggccgcgtctcccgtcaccgcgctctagg
gagacgtccgccgccgagcgacggcgggcactcgcggggccacggatgttggctccgcca
gaaccagcaaacttcagcctggacgaggtcatcagccgcactgtccaggctgtaatagaa
aggctgggcggcaggttggcagctctcgaggcgaaagtctcggtctcggctgacactagg
cggctggcggtgtcgggtgctttggccactcgtcctgctcccgtacgagctccggccacc
aagtcgggcccgggacgggctaaaaccaagcgagggggtggcgctatagcgaatcctcca
ctacaagcaccccagtcccgtccactgcctccgcctccgtcaaatatggacgaggggtgg
aacgtggtggccaggcggggcaccagaaaggccccaccggcagctcctcaaatgggtaga
gcgccggcggccaaggcggctcaagctgcaccccaacagggtcgagcgtctgaagccgcc
aagaaaaaccaaaaaaagaagttaccgcgcgcgcctcggtcggcagcagtggttcttacc
ctactgccagccgctgaagccaagggcatgacatacagagatgtcatcgcccgggcgcgt
gcggcagttgacctgggcgagattggggcggaggagggcctccgctgcaggcagacggcc
aacggggccaagctgctagaatgtcccgttgccgatagtgccggcatcgcggagcgtctg
gtggcgaagctccgtatggtcctacctgaggaggaggtgcgggtgcacaggccggtgaaa
atggccgaattaagagtaaccggcctggacgactgtaccaccagggatgaggtgatggcg
gctgtcgctgtccagggcaaatgcgcactggaaaatgtaaccgtaggcgagccgcgccgc
ggttataccggggccagctcggtgtgggtgcgttgcccggtggaggcggccgcctccctg
gctgctcccccgcccgggagaccgtcaggaaatccaggcatactgcgcgtgggctggata
gcggcccacgtacgcttgcttgagtcacgcgcctggcgatgccttcggtgctttagcact
ggacatggcttcgccaggtgcaccagctcggttgaccgcagcggtctatgtttccgctgc
ggccaacctggtcataaagcggcgtcctgcacggccgccccgcactgcgctctgtgcgct
gcggccgggcgtagggcaaaccaccgggcgggaggcaaggcttgcttcccgtccggtgtt
aatactgaacgcaaccggcgccgaaaatcaaggcgccggcagaagagaaggttggccaga
ggagcactggccaatgttgcaatccccgctgcggcgccggtgccggagggtgggggcagc
ggtgaagaggagggggcgatggatgtggttcaacagtaa

DBGET integrated database retrieval system