KEGG   Bombyx mori (domestic silkworm): 105841788Help
Entry
105841788         CDS       T02817                                 

Definition
(RefSeq) predicted GPI-anchored protein 58
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 105841788
NCBI-ProteinID: XP_012546749
Position
Un
AA seq 230 aa AA seqDB search
MEFSPTNTLLAEFLSEKYPALESEFLAYKAKRAVNCSAVPAAPAVSATPAVPASPASARK
TPAPYTAASVAPSTPVSPILSRKTPASTAAASVLPQRSSAASVASAAPAPSSSSSDSDSD
MEVDLVPASLTDGFTLVQKGKKRAAESRASAAAKISKAANASRPRPPTPVAPCPRATPSP
RPVAQTRNQAPPPLILQEKAAWDRVSLALKAKNINFVSARNLANGIQIKS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagttttctccaaccaacacactgctcgcggaattcttaagcgagaaatacccggcc
ctcgaatcagaatttttagcttacaaagctaaacgcgccgtgaactgttctgccgtgccc
gccgcgcccgccgtttccgccacgcctgccgttcccgcgtcccctgcaagcgcgcgcaaa
actcccgcgccgtacaccgcagcctccgtcgcgcccagcacacccgtgtcccccatactg
tcgcgaaaaactcccgcgtctaccgcggcagcttccgttctacctcagcgatcgtctgcg
gcctccgtcgcgtccgccgctcccgcgccttcctcctcgtcctccgactctgactcggat
atggaggttgacctcgttcccgcctcattaacagatggattcactctcgtgcaaaagggt
aagaagcgcgccgcggagtcccgagcttccgcggccgctaaaataagcaaagccgcgaac
gcgtcgcgcccccgccctccgacccccgtcgctccctgtccccgtgccacgccgtcgccg
cgcccggtggcacaaacgagaaatcaggcccctcctccgttgattcttcaagagaaggct
gcttgggaccgtgtctccctggcccttaaggccaagaacataaattttgtcagtgcccgt
aacctcgcgaacgggatacagataaaaagttaa

DBGET integrated database retrieval system