KEGG   Bombyx mori (domestic silkworm): 105841867
Entry
105841867         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC105841867
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB
Motif
Pfam: RVT_1
Other DBs
NCBI-GeneID: 105841867
NCBI-ProteinID: XP_012547033
Position
Un
AA seq 988 aa
MIDSQKQELSLAAVRAVHSGYRTRLFLYIGLNEFHVKLFGDTADDDTVLAIFLKRIAVIS
YMLLSEVSCKRAVVVGDDAIVGDSSTFISESDSESAMEDAAEVGMDESRDDGAVVSGDVG
AGADLSEVLGAVGATEGGDYCVVGTNEPTHVPTLARYQPDVLDVCVHKGLRCPLAIEALY
DLSTPHLPILVTVGLGLTRVATSPLRPRVDWQSFTGLLADQSLFQDPSTPDEVDTAASRL
VDTIRGALDQATTLVPSGGPRAELPVHLKTLIRRKRALRRLWATSRCPRIKRELNRLEDE
LATKMRTYRGDSWEGGLLNASDDRTMAPLHRICRRLTNKPSPTCPLEDEGGRRCFTPLAR
AEVLANSLERQFTPNVSAPSMVAFHREVSEGVIQFLKPESPGVELGDDDLVTPSEVRLLI
KLMKRRKAPGEDGIPPLALQNLPPSIVSAMTRLFNSILRAFDRVWHEGLVHKLRDAGLPH
AHVRLLGSYLEGRTFFVAVEGARSSVRPITAGVPQGSVLSPILYALYTNDIPTLEGHLRA
WKEDVRLALFADDSAYFSSSPFPSAAIMRMLLDLLPQWLDRWRVAVNVGKTAALLYGPVR
IRVVPKKLSLRGVNVEFRTTVRYLGCDIDRSLSMVAHVNRVIGQTRAARFLLRPVLASGL
PTSCVYEAVTMRRSTKVISLVNQSDKGEIKTCSRFMKIYFFVIYILTGFNFGFYTGCGLN
FLRVIQASVLLLRLSVASYSMYIARYSPLLEVIWCCLTASENLAVVVCFMLSRSALSCKN
LFEYLYSVDQELKKSVGPSIEVKLALYTVVVSVLRLIIYVFCATAYYRKLFDGLRLELLY
HTPCYSLDLYLVVHFTIFHSVYCRLKALRISLNEKFDVYKGTLIYKSLIDNLEEIKKSLD
VPLFVILLNAVAIAMINILVTLHISYGKTQHTAPEQAGFVERKGTREQYFFVRQIMEKAR
EFNMPTFICFVDFQKALDSVKWPQLWSL
NT seq 2967 nt   +upstreamnt  +downstreamnt
atgattgattctcagaaacaagaactttccctggccgctgtgcgtgcggtacacagcggc
taccggacacgattgttcctttatatcggtcttaatgagttccacgtcaaactctttggg
gacaccgcggatgacgacacggtgctcgcgatcttcttgaagcgtatagctgtgatatcc
tatatgctcctttcggaggtaagctgcaagcgcgcggtggtcgtgggggacgacgcgata
gtgggcgactcctctaccttcatctcggagtccgattcggagtcagcgatggaggacgca
gcggaagttggaatggacgaatcgcgtgacgacggcgcggtggtaagtggagatgtgggc
gcaggtgcagatctctcggaggtgttgggggcagtgggtgcgactgaggggggggactac
tgcgtggtcggcaccaacgaacccacccacgttccaacgttggcccggtaccaaccggac
gttttggacgtgtgtgttcacaaggggctacggtgccctctagcgatagaggcactgtac
gacctgagtacccctcacctaccgatcttggtcacggtgggtttggggctcactcgggtc
gcgacatcccctctcaggcctagggtcgactggcagtccttcacgggactgctggccgac
caatccctgtttcaagacccgtctacccctgatgaggtcgacacggcggcctcccgtctc
gtcgacaccatcaggggagccctggaccaagcgacgactctggtacccagcggggggccc
agagcggaactcccggtgcacctcaagacattaattcgtcggaagagggcactgaggagg
ctctgggcgacatctaggtgtcccaggattaagcgcgagctaaaccgacttgaggatgag
ctggcgactaagatgcggacttaccggggtgactcctgggaggggggactgttgaacgcg
tccgatgaccgtacgatggccccccttcaccgcatctgtcgccggctcacaaacaagcct
tcccccacttgccccttggaggacgaggggggaagacggtgttttacacccttggctcgt
gctgaagtcctggccaactcgctggagcggcagttcactccgaatgtctctgcaccctcg
atggttgcattccatcgggaggtgtcagagggcgtaatccaattcctcaaaccggaatcg
ccgggagtagagctgggagatgacgacttagtcactcctagcgaggtgcgcctcctcatc
aagctgatgaagaggcgcaaagcccccggcgaggacggtattcctcccctcgccttgcaa
aacctccctccctcaatcgtgtcagcaatgacacgattgtttaattccattctccgggcc
ttcgaccgtgtgtggcacgaggggctggtccacaagctgcgggacgcgggcctaccgcac
gctcacgtgcgactgctcgggtcgtacctggagggcagaaccttctttgtcgcggtcgag
ggcgcacggtcttccgtgcgtcccattacggccggggttccccagggtagtgtcctatca
cctatcctatacgccctctacaccaatgacatccccaccctggagggtcaccttcgggcg
tggaaggaggacgtgaggttggccttgttcgccgacgactcggcctacttctcgtcctct
ccgttcccctctgcagccattatgaggatgcttttggatttactgccccagtggctggac
cgttggagagtcgcggtcaatgtgggaaagaccgcggccttactctacggtccggtccgt
atcagagtcgtcccaaagaaactcagcctccgaggtgtgaatgtcgagttcaggaccacg
gtccggtatctcggatgcgacatcgaccgctccttgagcatggtcgcgcacgtcaaccga
gtcatcggtcagactcgcgcggccaggttcttgttgcggccggtgcttgcgtccgggctt
ccgaccagttgtgtttacgaggcagtcaccatgaggcgatcgacaaaagtcatctcgctg
gtcaaccagtcagataagggagaaatcaaaacatgttccagattcatgaagatatacttc
ttcgtgatttacattcttactggcttcaacttcggtttctacaccggctgcggcctcaac
ttcttgcgagtcatacaagcttcagtcttattactgagattaagcgtcgcttcatacagc
atgtatattgcacgttattccccgcttctggaagttatctggtgctgtttgactgccagt
gaaaacttagcggtagtggtgtgcttcatgctgagtagatctgctctgagctgcaagaac
ctgtttgagtacttgtacagtgtcgaccaggagttgaagaagagtgtcggtcccagcatc
gaagtgaagctcgcgctgtacacggtcgtggtgagcgtgctgagactgattatctacgtg
ttctgtgctaccgcctactacagaaaactgttcgatggacttcgcctcgagttgctctac
cacacaccttgttactcattggatctatatctcgtggtacactttacaatatttcattcg
gtttactgtcgactgaaggcgctgagaatatctctgaacgagaaatttgatgtttacaaa
ggtactctcatatacaagtcgttgattgataatttggaagaaatcaagaaaagtttggat
gttccgctcttcgtgatcctactaaacgcagtagccatagcgatgataaatattttggtg
acgttgcacatttcttatggaaaaacgcaacacacagcgccagaacaagctggttttgta
gagaggaaaggaacaagagaacagtacttttttgtgcgacaaataatggagaaggcgaga
gagttcaacatgccaacattcatctgctttgttgactttcaaaaagcattggactctgta
aaatggccacagttatggagtctttaa

DBGET integrated database retrieval system