KEGG   Bombyx mori (domestic silkworm): 105842068Help
Entry
105842068         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC105842068
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: Retrotran_gag_2 zf-CCHC DUF4219 zf-CCHC_2
Motif
Other DBs
NCBI-GeneID: 105842068
NCBI-ProteinID: XP_012548244
Position
Un
AA seq 294 aa AA seqDB search
MDSIKIKPFTNKDNYKAWRMLIKLLLDTKGIKIDGKNEEKLENKGKFIIFSYIEEKYLHY
VINLETIIEIFEKLDFMYDYNIQGQDIKHVMNFFEMQYSGNILEDINKLQNIQFEITSKE
NKISEQTFMHKILNLLPEKFNTFKSIWNNIDVEKKNLDELTRRIKNELEFTKEDSIIEAR
EILKGNEKGCFICNKPGHIARDVRINEGEQGILGGYLEDNEVINGLWGDERENTNRNNTN
ENNRADDEVREVREGDFRGNNSNEGNEVREGEIGRNGELVEFEKVIFEEIIVIK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggattcaataaagataaaacctttcacaaataaggataattataaagcttggagaatg
ctaattaaattattgctggatacaaagggtataaaaatagacggtaaaaatgaggaaaaa
ttggaaaataaggggaaatttataatatttagttatattgaagaaaaatatttacattat
gtaattaatttggaaacaattatagaaatttttgaaaaattagattttatgtatgattat
aatatacaaggacaagatataaaacacgtaatgaattttttcgagatgcaatattcagga
aacatattagaagatataaataaattacaaaacatacagtttgaaatcactagtaaagag
aacaaaatttcagaacaaacatttatgcacaaaattttaaatttattaccggaaaaattt
aatactttcaaatcaatttggaacaatatagacgtagaaaagaaaaatttagacgaatta
acccgaagaattaaaaatgaattggaattcaccaaagaagactctatcatagaagcccga
gaaattttaaaaggaaacgaaaaggggtgtttcatctgcaacaaaccagggcacatcgca
agggatgtaagaattaatgagggagaacaaggaattctaggtggatacttagaagataat
gaagtaattaatgggctttggggtgatgaaagggagaacactaatagaaataacacaaat
gaaaataatcgtgcagatgatgaagtcagagaagttcgagaaggtgattttagaggaaat
aatagtaatgaaggtaatgaagttcgagaaggtgaaataggaagaaatggagagttagtg
gagttcgagaaggtgatatttgaggaaataatagtaataaagtag

DBGET integrated database retrieval system