KEGG   Bombyx mori (domestic silkworm): 105842112Help
Entry
105842112         CDS       T02817                                 

Definition
(RefSeq) actin cytoskeleton-regulatory complex protein pan1-like
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_C2
Motif
Other DBs
NCBI-GeneID: 105842112
NCBI-ProteinID: XP_012548658
Position
Un
AA seq 279 aa AA seqDB search
MIEDRDSVSDSDFVGFLRERYPTIRAEYLAYRASRGNPSPPASVAAYFKRASEARRAPPA
AASSSSARSHDATHEAPSATPTPAPASVTSSRATSAATSIVSSSGSDTESEMDFESASSP
QPGTSDGFQTVTRGKKRTRAVESRSSTTKQTKSATASRPQVVVTPESDSARRVTPPPRPK
PAPAPKAAAPPPLILQEKTAWNRVSQALQANKINYTHARNVAHGIQIKVATPGDHRALSA
YLRKENIGFHTYALQEDRELRVVIRGVPKELDIDKKKKK
NT seq 838 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagatcgtgacagtgtcagtgatagtgattttgtcgggttcctccgggaaagg
tacccgacaattagggccgaatatctggcatatagggcctctcgtggcaatccctccccc
cccgcgtccgtcgccgcgtatttcaaacgtgcctcggaggcacgccgcgcaccccccgcc
gccgcgtcaagttcgagcgcacgttcccacgatgcgactcacgaagcgcctagcgctacc
cccacccccgcgcccgcgtcggttacgtcatcacgcgctacgtccgccgcgacctcgatc
gtttcaagttcaggctccgataccgaatcggagatggatttcgaatccgcgtcaagccct
cagcctggaacttcggatgggttccaaaccgtaacgcgcggtaaaaagcgtactcgcgcc
gtggagtcccggagctccacgacgaagcagacaaaatccgcgaccgcctcccgcccgcag
gtagtcgtgacaccggagtcggactccgctcgccgcgtaaccccgccgccgcgtcccaag
cccgcgcccgctcctaaagcagctgccccgcccccgctgattctccaggaaaaaactgcg
tggaaccgcgtttcccaggcccttcaggcaaataaaattaattatacccatgcgcgtaac
gtcgcgcatgggattcagataaaggtcgcaacgccgggcgaccatagggccctctcagca
tacctccgaaaggagaacataggtttccacacctatgctcttcaggaggaccgcgagctc
cgcgtagtgatacgcggagtccctaaagaactcgacatcgacaaaaaaaaaaaaaaaa

DBGET integrated database retrieval system